vitamins
440 postspacheco105: Just another day
pacheco105 (pacheco105)
today...it was pretty good! i am going to start taking them every day...it has tons of vitamins...and what not well one week till my 18th birthday, can't wait! i have my modeling class ...
pacheco105 (pacheco105)
today...it was pretty good! i am going to start taking them every day...it has tons of vitamins...and what not well one week till my 18th birthday, can't wait! i have my modeling class ...
mirel
mirel (mirel)
love her but oh goodness me if i hear one more "did you take your vitamins" "when are you going to......
mirel (mirel)
love her but oh goodness me if i hear one more "did you take your vitamins" "when are you going to......
snack: because sweetie is out of town ...
snack (snack)
this morning. i've taken calcium, vitamin D, potassium, and magnesium, plus some other vitamins. i'm drinking water. it hurts to walk. my forearm is trying to...
snack (snack)
this morning. i've taken calcium, vitamin D, potassium, and magnesium, plus some other vitamins. i'm drinking water. it hurts to walk. my forearm is trying to...
tearsofblood05: random fact of the day
tearsofblood05 (tearsofblood05)
sex massages the jaw... while burning 32 calories. Swallowing foreign body juices is actually like taking vitamins. Having nice SEX burns 358 Calories. Having RoUgH SEX burns 543 calories. ......
tearsofblood05 (tearsofblood05)
sex massages the jaw... while burning 32 calories. Swallowing foreign body juices is actually like taking vitamins. Having nice SEX burns 358 Calories. Having RoUgH SEX burns 543 calories. ......
kevynallen
Kevyn (kevynallen)
off..The coming weeks are incredibly busy for me coming up. I need to take my vitamins (over 40 now...Geritol??lol). Just talked to my one of my godfather's in Miami ...
Kevyn (kevynallen)
off..The coming weeks are incredibly busy for me coming up. I need to take my vitamins (over 40 now...Geritol??lol). Just talked to my one of my godfather's in Miami ...
pixy85: i saw this in cherbear's myspace and thought it was HILARIOUS!
pixy85 (pixy85)
semen cuts down plaque and tartar by 77% Swallowing foreign body juices is actually like taking vitamins. Having nice SEX burns 358 Calories. Having RoUgH SEX burns 543 calories. ......
pixy85 (pixy85)
semen cuts down plaque and tartar by 77% Swallowing foreign body juices is actually like taking vitamins. Having nice SEX burns 358 Calories. Having RoUgH SEX burns 543 calories. ......
hoboism: Just Mix 'Em Together
Future Dynamite Museum Member (hoboism)
but who even knows. I've decided to make my own ADD medication, here's what you'll need: Ingredients: -Flintstones vitamins (orange) -Applesauce -Cinnemon -Kentucky Straight Bourbon -Two sugar packets -Fifteen grams of cocain -A bucket with a strong handle -An encyclopedia -Seventeen ...
Future Dynamite Museum Member (hoboism)
but who even knows. I've decided to make my own ADD medication, here's what you'll need: Ingredients: -Flintstones vitamins (orange) -Applesauce -Cinnemon -Kentucky Straight Bourbon -Two sugar packets -Fifteen grams of cocain -A bucket with a strong handle -An encyclopedia -Seventeen ...
_lameusername
_lameusername (_lameusername)
vitamins for dieters. The diet one is supposed to help you metabolism, and it has...
_lameusername (_lameusername)
vitamins for dieters. The diet one is supposed to help you metabolism, and it has...
edwartica: Bashing Tom Cruise seems to be my new hobby...
ʾAhărōn (edwartica)
tells me one thing: you didn’t spend $10. to see War Of The Worlds. If vitamins can possibly help me out of this spiraling funk, please let me know which ...
ʾAhărōn (edwartica)
tells me one thing: you didn’t spend $10. to see War Of The Worlds. If vitamins can possibly help me out of this spiraling funk, please let me know which ...
bearfoo: Lalala
bearfoo (bearfoo)
ex massages the jaw... while burning 32 calories. Swallowing foreign body juices is actually like taking vitamins. Having nice SEX burns 358 Calories. Having RoUgH SEX burns 543 calories. You know what you must ...
bearfoo (bearfoo)
ex massages the jaw... while burning 32 calories. Swallowing foreign body juices is actually like taking vitamins. Having nice SEX burns 358 Calories. Having RoUgH SEX burns 543 calories. You know what you must ...
2sac: last night
Neo Ping (2sac)
show up and a 100% chance that some one is gunna let go of their vitamins if you know what I......
Neo Ping (2sac)
show up and a 100% chance that some one is gunna let go of their vitamins if you know what I......
robyna1: Okay...
robyna1 (robyna1)
by walking/jogging for 4 days in a row, staying strictly on my diet, taking my vitamins and keeping immaculate care of my body. I plan on jogging again today and ...
robyna1 (robyna1)
by walking/jogging for 4 days in a row, staying strictly on my diet, taking my vitamins and keeping immaculate care of my body. I plan on jogging again today and ...
mrsshelor2b: So...
mrsshelor2b (mrsshelor2b)
is it with me and always getting sick? I've been trying to do better...taking my vitamins, exercising, eating better, drinking milk...but nothing seems to work! Grrr...Anyway...I don't really know what ...
mrsshelor2b (mrsshelor2b)
is it with me and always getting sick? I've been trying to do better...taking my vitamins, exercising, eating better, drinking milk...but nothing seems to work! Grrr...Anyway...I don't really know what ...
pullout_images: no fucking shoes.
(!) Adam (pullout_images)
a shit load of energy bars. random magazines. a hot dog. those creepy as hell vitamins next to the......
(!) Adam (pullout_images)
a shit load of energy bars. random magazines. a hot dog. those creepy as hell vitamins next to the......
bigmojo: Quote of the Day
Jason (bigmojo)
vitamins most commonly found in cereals." -Carbom Lvl 37 Tauren Shaman This fine upstanding smart ass makes up random...
Jason (bigmojo)
vitamins most commonly found in cereals." -Carbom Lvl 37 Tauren Shaman This fine upstanding smart ass makes up random...
xtouchme: anemia.
xtouchme (xtouchme)
vitamins so i can get more iron in my blood, and they make me feel sicker...
xtouchme (xtouchme)
vitamins so i can get more iron in my blood, and they make me feel sicker...
deadasdaisies
Grace (deadasdaisies)
by a train. It's pretty gross. I woke up and treated myself to vitamins and an instant brekfast. I looked at the clock and realized alex was ...
Grace (deadasdaisies)
by a train. It's pretty gross. I woke up and treated myself to vitamins and an instant brekfast. I looked at the clock and realized alex was ...
screamsforhelp
screamsforhelp (screamsforhelp)
soon. It really is nice bein home. I like how I can take all my vitamins (EPA, B12, Quercitin, Garlic, zinc...) & my whatever it is, illness is going away. ...
screamsforhelp (screamsforhelp)
soon. It really is nice bein home. I like how I can take all my vitamins (EPA, B12, Quercitin, Garlic, zinc...) & my whatever it is, illness is going away. ...
shakidira
Esther (shakidira)
I took tylenol, yet I still don't feel well. I ate breakfast, had my vitamins, and am drinking water. I think it just might be my wierd sleeping ...
Esther (shakidira)
I took tylenol, yet I still don't feel well. I ate breakfast, had my vitamins, and am drinking water. I think it just might be my wierd sleeping ...
goregirl
Goregirl (goregirl)
vitamins, and doing yoga. In the immortal words of Jay.."I just looked in the mirrow one...
Goregirl (goregirl)
vitamins, and doing yoga. In the immortal words of Jay.."I just looked in the mirrow one...
lilsundrop (in _dolphinlovers_): JUST AN UPDATE ON THE STRANDED ROUGH-TOOTHED DOLPHINS
Holly (lilsundrop)
EDT (1423 GMT) var clickExpire = "-1"; Volunteers hand feed the dolphins herring stuffed with vitamins. if(!cnnUseDelayedCSI){cnnAddCSI('imageChanger0','/2005/TECH/science/04/13/dolphin.rehab/imgChng/p0-0.exclude.html','pNo=0');} if(cnnEnableCL){if(!(location.hostname.indexOf('cnn.com')>-1)) {cnnAddCSI('contextualLinks','/.element/ssi/sect/1.1/misc/contextual/story.html','');}else{ cnnAddCSI('contextualLinks','http:/\/cl.cnn.com/ctxtlink/jsp/cnn-story.jsp','category=cnnscience&url=http:/\/robots.cnn.com/2005/TECH/science/04/13/dolphin.rehab/index.html&site=cnn_science_dyn_ctxt');}} KEY LARGO, Florida (CNN) -- In early March an estimated 80 rough-toothed dolphins stranded themselves in the shallows off Marathon in the Florida Keys. Rescue workers and volunteers worked nonstop to help as many as they could to return to deep water. Some dolphins made it. About two dozen died. For 26 that clung to life there was only one chance for survival --......
Holly (lilsundrop)
EDT (1423 GMT) var clickExpire = "-1"; Volunteers hand feed the dolphins herring stuffed with vitamins. if(!cnnUseDelayedCSI){cnnAddCSI('imageChanger0','/2005/TECH/science/04/13/dolphin.rehab/imgChng/p0-0.exclude.html','pNo=0');} if(cnnEnableCL){if(!(location.hostname.indexOf('cnn.com')>-1)) {cnnAddCSI('contextualLinks','/.element/ssi/sect/1.1/misc/contextual/story.html','');}else{ cnnAddCSI('contextualLinks','http:/\/cl.cnn.com/ctxtlink/jsp/cnn-story.jsp','category=cnnscience&url=http:/\/robots.cnn.com/2005/TECH/science/04/13/dolphin.rehab/index.html&site=cnn_science_dyn_ctxt');}} KEY LARGO, Florida (CNN) -- In early March an estimated 80 rough-toothed dolphins stranded themselves in the shallows off Marathon in the Florida Keys. Rescue workers and volunteers worked nonstop to help as many as they could to return to deep water. Some dolphins made it. About two dozen died. For 26 that clung to life there was only one chance for survival --......
selkie_baby: So this is kind of a random entry...
selkie_baby (selkie_baby)
me or anyone else who happens to be in the line of fire. Ran out of vitamins and my body was craving iron. Ate a lunch consisting entirely of green vegetables. ...
selkie_baby (selkie_baby)
me or anyone else who happens to be in the line of fire. Ran out of vitamins and my body was craving iron. Ate a lunch consisting entirely of green vegetables. ...
eirryberry
eirryberry (eirryberry)
rts again", the cycle rears its ugly head. I really should have taken my vitamins since I am working crazy hours and not always eating 3 (or even 2 ...
eirryberry (eirryberry)
rts again", the cycle rears its ugly head. I really should have taken my vitamins since I am working crazy hours and not always eating 3 (or even 2 ...
kraft_girl: stolen from kaarina to keep me busy while cleaning my comp
kraft_girl (kraft_girl)
supposed to do daily that you have not done in a long time? Taken my vitamins 2. What is the latest you've ever......
kraft_girl (kraft_girl)
supposed to do daily that you have not done in a long time? Taken my vitamins 2. What is the latest you've ever......
mob_psychology
Angeleena (mob_psychology)
THAT SCARE YOU: 1. Arachnids 2. Eye surgery 3. Growing old THREE OF YOUR EVERYDAY ESSENTIALS: 1. Caffeine 2. Music 3. Vitamins THREE THINGS YOU ARE WEARING RIGHT NOW: 1. Pajama pants 2. T-shirt 3. Underwear THREE OF YOUR FAVORITE BANDS O...
Angeleena (mob_psychology)
THAT SCARE YOU: 1. Arachnids 2. Eye surgery 3. Growing old THREE OF YOUR EVERYDAY ESSENTIALS: 1. Caffeine 2. Music 3. Vitamins THREE THINGS YOU ARE WEARING RIGHT NOW: 1. Pajama pants 2. T-shirt 3. Underwear THREE OF YOUR FAVORITE BANDS O...
cosmic_cow: Getting Diagnosed...
cosmic_cow (cosmic_cow)
to get the kinks out and the alignment back in. i'm totally lacking in plenty of vitamins and minerals (think calcium, magnesium, iron, vitamins B5 and B6, vitamin A). my liver ...
cosmic_cow (cosmic_cow)
to get the kinks out and the alignment back in. i'm totally lacking in plenty of vitamins and minerals (think calcium, magnesium, iron, vitamins B5 and B6, vitamin A). my liver ...
seaoutcast: not dying
seaoutcast (seaoutcast)
all chewy. Chewy? Who overdoses on chewable pills? Were they children's vitamins? I may ask my boss to start working 4 tens. I would request...
seaoutcast (seaoutcast)
all chewy. Chewy? Who overdoses on chewable pills? Were they children's vitamins? I may ask my boss to start working 4 tens. I would request...
rachelute
Mrs. Hossifer (rachelute)
that I admire because what if they're not cool or something?" - Tom Cruise "If vitamins and exercise alone explain why Tom Cruise is so, um, knowledgeable and well-grounded, pass ...
Mrs. Hossifer (rachelute)
that I admire because what if they're not cool or something?" - Tom Cruise "If vitamins and exercise alone explain why Tom Cruise is so, um, knowledgeable and well-grounded, pass ...
mistakeofchoice
harleigh <333 (mistakeofchoice)
today when fallon and I took the boys and peyton-satan swimming. fucking great. ive finally boughten vitamins today. im proud. I bought the killers album finally too. and p.s. im putting in my two weeks...
harleigh <333 (mistakeofchoice)
today when fallon and I took the boys and peyton-satan swimming. fucking great. ive finally boughten vitamins today. im proud. I bought the killers album finally too. and p.s. im putting in my two weeks...
bijouxamour: I need...
Kate, Kate, Little Kate (bijouxamour)
my time filled while I hope that people come in and buy healthful herbs and vitamins. Sci-fi, self-help or celebrity biographies need not apply.......
Kate, Kate, Little Kate (bijouxamour)
my time filled while I hope that people come in and buy healthful herbs and vitamins. Sci-fi, self-help or celebrity biographies need not apply.......
x_jaimee_x: update
x_jaimee_x (x_jaimee_x)
tomorrow.or any mall with mercury drug.but i like mercury in glorietta best.i have to buy vitamins for uhh.my sisters.so there.i'm clubless.hate it.......
x_jaimee_x (x_jaimee_x)
tomorrow.or any mall with mercury drug.but i like mercury in glorietta best.i have to buy vitamins for uhh.my sisters.so there.i'm clubless.hate it.......
sublimeparadigm: Vitamins - 30_kisses #28 [chapter 15 ~interlude~]
I smell like a GENIUS!!! (sublimeparadigm)
Vitamins Author: sublimeparadigm Pairing: Atobe Keigo x Kamio Akira Theme: #28 - Wada Calcium CD3 Chapter: 15/30 ~Interlude~ Rating: PG-13 Notes:...
I smell like a GENIUS!!! (sublimeparadigm)
Vitamins Author: sublimeparadigm Pairing: Atobe Keigo x Kamio Akira Theme: #28 - Wada Calcium CD3 Chapter: 15/30 ~Interlude~ Rating: PG-13 Notes:...
pimp_transit: A failed attempt at emo
Shakes Gunslinger (pimp_transit)
family has gratuitously given to me last Friday with a glass of water and vitamins to wash it all down, I feel like I'm on the brink of a change....
Shakes Gunslinger (pimp_transit)
family has gratuitously given to me last Friday with a glass of water and vitamins to wash it all down, I feel like I'm on the brink of a change....
snain: Today is Sunday
CadBury (snain)
u want but this thing's nice .anyway, nose blocked, appetite's out.i shall just eat some vitamins my grandma had recommended.maybe i wouldn't even need to eat veggies anymore.wahaha.cause that tablet ...
CadBury (snain)
u want but this thing's nice .anyway, nose blocked, appetite's out.i shall just eat some vitamins my grandma had recommended.maybe i wouldn't even need to eat veggies anymore.wahaha.cause that tablet ...
whineandshine
whineandshine (whineandshine)
semen cuts down plaque and tartar by 77% Swallowing foreign body juices is actually like taking vitamins. Having nice SEX burns 358 Calories. Having RoUgH SEX burns 543 calories. ......
whineandshine (whineandshine)
semen cuts down plaque and tartar by 77% Swallowing foreign body juices is actually like taking vitamins. Having nice SEX burns 358 Calories. Having RoUgH SEX burns 543 calories. ......
agnor
Ron (agnor)
my shampoo do not concern me, and satisfaction because I'll not settle for mere amateur vitamins, thank you very much.......
Ron (agnor)
my shampoo do not concern me, and satisfaction because I'll not settle for mere amateur vitamins, thank you very much.......
californiarower
californiarower (californiarower)
favorite hobby: writting :x: favorite friends: i like all my friends :x: bar or club: club :x: favorite vitamins: B-12 :x: favorite show: spongebob! :x: favorite news: ch. 7 :x: gold or silver: silver fo sho :x: ...
californiarower (californiarower)
favorite hobby: writting :x: favorite friends: i like all my friends :x: bar or club: club :x: favorite vitamins: B-12 :x: favorite show: spongebob! :x: favorite news: ch. 7 :x: gold or silver: silver fo sho :x: ...
gigges4eva
Niki (gigges4eva)
they will be fine in a couple of weeks. Steve wants to buy me these vitamins that will help grow my nails back faster, werid?? I leave for the cape ...
Niki (gigges4eva)
they will be fine in a couple of weeks. Steve wants to buy me these vitamins that will help grow my nails back faster, werid?? I leave for the cape ...
lawn_mama: ~FOURTH time is the charm?~
lawn_mama (lawn_mama)
plunge and invested in sea bands. I am cautiously optimistic. Let's recap my anti-puke protocol: 1)Mega-B vitamins 2)Exercise 3)Water 4)Food 5)Sleep 6)Sea Bands......
lawn_mama (lawn_mama)
plunge and invested in sea bands. I am cautiously optimistic. Let's recap my anti-puke protocol: 1)Mega-B vitamins 2)Exercise 3)Water 4)Food 5)Sleep 6)Sea Bands......
flummoxed_me: Yea for precipitation
flummoxed_me (flummoxed_me)
at least 3 pounds recently, poor baby. The doc gave us (well Romeo, really) some vitamins and deer meat. Perhaps he has some sort of blockage? I also recently rediscovered my ...
flummoxed_me (flummoxed_me)
at least 3 pounds recently, poor baby. The doc gave us (well Romeo, really) some vitamins and deer meat. Perhaps he has some sort of blockage? I also recently rediscovered my ...
xfaustxx: manorexia
a silent film that never ends (xfaustxx)
horrible watching it...like i needed to call the creators and make sure he was taking vitamins or something. at least batman was made after it proving he recovered quite well....ugh. on ...
a silent film that never ends (xfaustxx)
horrible watching it...like i needed to call the creators and make sure he was taking vitamins or something. at least batman was made after it proving he recovered quite well....ugh. on ...
misshottness05: ha ha..
misshottness05 (misshottness05)
semen cuts down plaque and tartar by 77% Swallowing foreign body juices is actually like taking vitamins. Having nice SEX burns 358 Calories. Having RoUgH SEX burns 543 calories. ......
misshottness05 (misshottness05)
semen cuts down plaque and tartar by 77% Swallowing foreign body juices is actually like taking vitamins. Having nice SEX burns 358 Calories. Having RoUgH SEX burns 543 calories. ......
yore_stupid: SKEET SKEET!
NADROJ SPELLED SDROWKCAB (yore_stupid)
ye, fuck her in the eye. Blind the bitch, blind the bitch..." I took all my vitamins on an empty stomach today. I almost barfed. It made me feel so sick. ...
NADROJ SPELLED SDROWKCAB (yore_stupid)
ye, fuck her in the eye. Blind the bitch, blind the bitch..." I took all my vitamins on an empty stomach today. I almost barfed. It made me feel so sick. ...
getinluckyin_ky
olivia* (getinluckyin_ky)
i got there and it was me la and sam and we got la's dad vitamins haha and looked at the vitamin magazine with all the hott men haha then......
olivia* (getinluckyin_ky)
i got there and it was me la and sam and we got la's dad vitamins haha and looked at the vitamin magazine with all the hott men haha then......
sprungbaby: QuiZ*!
.:*HeAtHeR*:. .:. .:*LyNnE*:. (sprungbaby)
D's I Guess*! :x: Favorite hobby: Partying and Shopping*! :x: Favorite friends: All My Girls! :-) :x: Favorite vitamins: Flintstone Ones; Even Tho I Haven't Had......
.:*HeAtHeR*:. .:. .:*LyNnE*:. (sprungbaby)
D's I Guess*! :x: Favorite hobby: Partying and Shopping*! :x: Favorite friends: All My Girls! :-) :x: Favorite vitamins: Flintstone Ones; Even Tho I Haven't Had......
ecstaticplastic
post-plastic★neo-ecstatic (ecstaticplastic)
out for lack of iron and B12. a trip to the drugstore, two rounds of vitamins & one day later, i already feel better. i havent eaten in more then ...
post-plastic★neo-ecstatic (ecstaticplastic)
out for lack of iron and B12. a trip to the drugstore, two rounds of vitamins & one day later, i already feel better. i havent eaten in more then ...
gin_rn07: Test Grade
gin_rn07 (gin_rn07)
3rd test in Nutrition, I made a 86. This test was over all the vitamins, minerals, and trace minerals. The grades for the semester are: Test 1 - 86 Test 2 - ...
gin_rn07 (gin_rn07)
3rd test in Nutrition, I made a 86. This test was over all the vitamins, minerals, and trace minerals. The grades for the semester are: Test 1 - 86 Test 2 - ...
ardra_morrigan: Nothing to see here.
Ardra (ardra_morrigan)
sure I can't take any more stress. Had an allergic reaction to one of my new vitamins yesterday. Hives the size of a dinner plate. Fortunately it was just a skin ...
Ardra (ardra_morrigan)
sure I can't take any more stress. Had an allergic reaction to one of my new vitamins yesterday. Hives the size of a dinner plate. Fortunately it was just a skin ...
amphetamineamy
Kat S. (amphetamineamy)
some late-night dinner at a certain place famous for their tomato soup. Okay, so... taking vitamins upsets my stomach. I'm not a stereotypical girl. I like porn. I play video...
Kat S. (amphetamineamy)
some late-night dinner at a certain place famous for their tomato soup. Okay, so... taking vitamins upsets my stomach. I'm not a stereotypical girl. I like porn. I play video...
faeriemage: word on the street
jessie (faeriemage)
vitamins. the company is "nature made" which i've heard of before... triple flex dboule strength glucosamine chondroitin...
jessie (faeriemage)
vitamins. the company is "nature made" which i've heard of before... triple flex dboule strength glucosamine chondroitin...
xxredrosesxx
red....roses (xxredrosesxx)
of her lungs :: any ways im tired , so tired i need to start taking vitamins again...i think it might help me some. and today i got my package :)......
red....roses (xxredrosesxx)
of her lungs :: any ways im tired , so tired i need to start taking vitamins again...i think it might help me some. and today i got my package :)......
jewcooker: I, Monarch
Gabriel (jewcooker)
done though, and now my arms are flaccid. That's why we have Ultra Mega Green vitamins. I feel superhuman when I take them.......
Gabriel (jewcooker)
done though, and now my arms are flaccid. That's why we have Ultra Mega Green vitamins. I feel superhuman when I take them.......
roeatelkins: MY LEARNINGS TODAY AT WORK..
roeatelkins (roeatelkins)
SODA BOTTLE- ONE OF THE TWO SODAS I ONLY DRINK), MINTS, JELLO, GUM, CEREAL, CHEWABLE VITAMINS, TABLE TOP SWEETNERS, LEMONADE, KOOL AID, DIRED FRUIT... ETC!! IT CAUSES SOO MANY PROBLEMS ...
roeatelkins (roeatelkins)
SODA BOTTLE- ONE OF THE TWO SODAS I ONLY DRINK), MINTS, JELLO, GUM, CEREAL, CHEWABLE VITAMINS, TABLE TOP SWEETNERS, LEMONADE, KOOL AID, DIRED FRUIT... ETC!! IT CAUSES SOO MANY PROBLEMS ...
forevermine07
forevermine07 (forevermine07)
ys i went to the market and i bought some one a day dietay supplementary vitamins. Well your suppoe to take them with food but i dont and it makes ...
forevermine07 (forevermine07)
ys i went to the market and i bought some one a day dietay supplementary vitamins. Well your suppoe to take them with food but i dont and it makes ...
boyhitstrain
Cannon Fodder (boyhitstrain)
mud of a one-night stand. The saints in regalia whistling while they rape. Lid clamps in vitamins. Lift up her skirt......
Cannon Fodder (boyhitstrain)
mud of a one-night stand. The saints in regalia whistling while they rape. Lid clamps in vitamins. Lift up her skirt......
ginana03: Brand Name Condoms ~Compliments of Raesha~
ginana03 (ginana03)
the right one baby Pringles Condoms: Once you pop you can't stop Mentos Condoms: The freshmaker Flinstones Vitamins Condoms Pack: Ten million and growing strong Secret Condoms: Strong enough for a man, pH balanced...
ginana03 (ginana03)
the right one baby Pringles Condoms: Once you pop you can't stop Mentos Condoms: The freshmaker Flinstones Vitamins Condoms Pack: Ten million and growing strong Secret Condoms: Strong enough for a man, pH balanced...
anything2bethin
anything2bethin (anything2bethin)
vitamins? what about chewable vitamins? could you take one a day and live off of them? if not why?......
anything2bethin (anything2bethin)
vitamins? what about chewable vitamins? could you take one a day and live off of them? if not why?......
wasteliketoxic
wasteliketoxic (wasteliketoxic)
help boost your metabolism, plus its anti-oxidants make your skin look great. 4. Take vitamins daily. Do not take vitamins on an empty stomache, otherwise they have nothing to ...
wasteliketoxic (wasteliketoxic)
help boost your metabolism, plus its anti-oxidants make your skin look great. 4. Take vitamins daily. Do not take vitamins on an empty stomache, otherwise they have nothing to ...
thornflower: triglycerides!
Eclipse (thornflower)
pressure. Total Cholesterol 203mg/dL Triglycerides 204mg/dL HDL Cholesterol 65mg/dL LDL Cholesterol 97mg/dL Glucose Fasting 88mg/dL so yea, bought some Omega-3 vitamins since i don't have any fish in my diet and my gawd they're huge and...
Eclipse (thornflower)
pressure. Total Cholesterol 203mg/dL Triglycerides 204mg/dL HDL Cholesterol 65mg/dL LDL Cholesterol 97mg/dL Glucose Fasting 88mg/dL so yea, bought some Omega-3 vitamins since i don't have any fish in my diet and my gawd they're huge and...
_bok_choy_: Stolen! From Jai!
Amy (_bok_choy_)
favorite hobby: Sleeping.:x: favorite friends: Most of them.:x: bar or club: Ahhh.... ENVY!!! JK.:x: favorite vitamins: The ones in my fruit and veggies.:x: favorite show:Dawson's Creek.:x: favorite news: Getting accepted ...
Amy (_bok_choy_)
favorite hobby: Sleeping.:x: favorite friends: Most of them.:x: bar or club: Ahhh.... ENVY!!! JK.:x: favorite vitamins: The ones in my fruit and veggies.:x: favorite show:Dawson's Creek.:x: favorite news: Getting accepted ...
whore_nun
working title (whore_nun)
age? i'm 24, but in my mind i'm Sophia Petrillo. i bought some stress formula vitamins at the overpriced grocery store. they say they're for times when you physically overextend ...
working title (whore_nun)
age? i'm 24, but in my mind i'm Sophia Petrillo. i bought some stress formula vitamins at the overpriced grocery store. they say they're for times when you physically overextend ...
irish_siren
Liz (irish_siren)
then you realize you need weather gear, office supplies, sunscreen, bug spray, cups, plates, fridge,vitamins, electronics etc etc ETC. IT's crazy man. I have a packing list that was 4...
Liz (irish_siren)
then you realize you need weather gear, office supplies, sunscreen, bug spray, cups, plates, fridge,vitamins, electronics etc etc ETC. IT's crazy man. I have a packing list that was 4...
no_mo_tallow: Day Six: Phase One
no_mo_tallow (no_mo_tallow)
Six: Phase One Fuel = xxxx calories & xx grams of carb. Exercise: Total Water Consumption: Vitamins: Important Reflections on Day Six: Day Six/Phase One Comparisons: (Grand Total of x calories & ...
no_mo_tallow (no_mo_tallow)
Six: Phase One Fuel = xxxx calories & xx grams of carb. Exercise: Total Water Consumption: Vitamins: Important Reflections on Day Six: Day Six/Phase One Comparisons: (Grand Total of x calories & ...
spiffiemclure: Watcha gonna do when the hulkster runs wild on YOU?!?!
Spiffie McLure (spiffiemclure)
vitamins and you will never go wrong." ......
Spiffie McLure (spiffiemclure)
vitamins and you will never go wrong." ......
xsomberangelx: My blood is a burgondy colour.
meagan (xsomberangelx)
could be the 'emer-gen c' though, I felt that after the vampire-age I needed vitamins.) so what they do is hook you up to a needle then pull out a...
meagan (xsomberangelx)
could be the 'emer-gen c' though, I felt that after the vampire-age I needed vitamins.) so what they do is hook you up to a needle then pull out a...
standsforhero: Medicine
standsforhero (standsforhero)
the light headedness, the scary feelings. ironically the pills are ephedrine free and mostly vitamins. at one point i was void of any emotion whatsoever. not depressed, angry, sad, scared,...
standsforhero (standsforhero)
the light headedness, the scary feelings. ironically the pills are ephedrine free and mostly vitamins. at one point i was void of any emotion whatsoever. not depressed, angry, sad, scared,...
concorde: Product warning
minty fresh (concorde)
arms at CVS. Sally Hansen's spa wax, or something like that. Lavender! Vitamins! This wax will leave you with baby-smooth skin, sang the box. Initially, everything said ...
minty fresh (concorde)
arms at CVS. Sally Hansen's spa wax, or something like that. Lavender! Vitamins! This wax will leave you with baby-smooth skin, sang the box. Initially, everything said ...
halfofanangel
halfofanangel (halfofanangel)
Vitamins ~ Done Breakfast ~ Done Snack ~ Lunch ~ Dinner ~ HAPPY BIRTHDAY TO ME, HAPPY BIRTHDAY...
halfofanangel (halfofanangel)
Vitamins ~ Done Breakfast ~ Done Snack ~ Lunch ~ Dinner ~ HAPPY BIRTHDAY TO ME, HAPPY BIRTHDAY...
stephanyylee: make a noise!!!!!!!
stephanyylee (stephanyylee)
it's main objective is to make money and have pharmicutical companies control all natural herbs, vitamins, teas ect....meaning that the drug companies will have full control over everything-meaning they plan ...
stephanyylee (stephanyylee)
it's main objective is to make money and have pharmicutical companies control all natural herbs, vitamins, teas ect....meaning that the drug companies will have full control over everything-meaning they plan ...
a_m_a_n_d_u_h
...... (a_m_a_n_d_u_h)
SO good. The tea fills me up and the mixture I make provides nutrients and vitamins... and it tastes SO good. Everyone thinks I'm crazy [except GRACE ......
...... (a_m_a_n_d_u_h)
SO good. The tea fills me up and the mixture I make provides nutrients and vitamins... and it tastes SO good. Everyone thinks I'm crazy [except GRACE ......
sugarspice337: chilling while i wait for ppl to get ready
sugarspice337 (sugarspice337)
just learned how to photoplay and it's pretty cool :x: favorite friends: all of them :x: favorite vitamins: flinstones :x: favorite show: classic SNL, the OC, and gilmore girls :x: gold or silver: silver :x: ...
sugarspice337 (sugarspice337)
just learned how to photoplay and it's pretty cool :x: favorite friends: all of them :x: favorite vitamins: flinstones :x: favorite show: classic SNL, the OC, and gilmore girls :x: gold or silver: silver :x: ...
darkdragonfly3: goals for 05-06 school year::
darkdragonfly3 (darkdragonfly3)
be the best damn vice president for best buddies i can 11. remember to take vitamins 12. get jessica and andrew saved 13. get a 4 on my ap tests in may 1...
darkdragonfly3 (darkdragonfly3)
be the best damn vice president for best buddies i can 11. remember to take vitamins 12. get jessica and andrew saved 13. get a 4 on my ap tests in may 1...
oceans_diet: Aug 20, 2005
oceans_diet (oceans_diet)
gr fat 1 banana 1/2 cup low fat raspberry yogurt, 2 tbsp bran 1 oz light medium cheddar vitamins 3 coffee 1oz 5% vanilla cream, equal Black bean soup 170 cal 1.9 gr fat 8 soda c...
oceans_diet (oceans_diet)
gr fat 1 banana 1/2 cup low fat raspberry yogurt, 2 tbsp bran 1 oz light medium cheddar vitamins 3 coffee 1oz 5% vanilla cream, equal Black bean soup 170 cal 1.9 gr fat 8 soda c...
sexyg0pher770: HELLO!!!
sexyg0pher770 (sexyg0pher770)
know why... ill meditate on that l8er. Anyway sisnce i started taking the vitamins im happier and not tired even if i get 6 hours of sleep like last...
sexyg0pher770 (sexyg0pher770)
know why... ill meditate on that l8er. Anyway sisnce i started taking the vitamins im happier and not tired even if i get 6 hours of sleep like last...
space2breathein: Opinions were like kittens, I was givin' em away.
Cait (space2breathein)
will have my say. One-by-one I will regurgitate Your lies- the pill-form oppression I swallowed as vitamins my whole life. And this simple illusion reveals the unknowing But if you straight look at the...
Cait (space2breathein)
will have my say. One-by-one I will regurgitate Your lies- the pill-form oppression I swallowed as vitamins my whole life. And this simple illusion reveals the unknowing But if you straight look at the...
sinisterfeeling
candy (sinisterfeeling)
and weak and now I'm detoxing. Me stupid too, I totally forgot to take my daily vitamins for 2-3 days last week. We finally heard from my brother last night. Mom broke ...
candy (sinisterfeeling)
and weak and now I'm detoxing. Me stupid too, I totally forgot to take my daily vitamins for 2-3 days last week. We finally heard from my brother last night. Mom broke ...
_surrealist_: An Exciting Update of Nada
Something Twisted (_surrealist_)
yesterday. It's 80 right now. :\ UG! I've learned not to take my new vitamins before I eat. :X Nicked from 1. Gangsta's Paradise, Coolio 2. Waterfalls, TLC ...
Something Twisted (_surrealist_)
yesterday. It's 80 right now. :\ UG! I've learned not to take my new vitamins before I eat. :X Nicked from 1. Gangsta's Paradise, Coolio 2. Waterfalls, TLC ...
wildharlequin: pink robots!!! AHHHHHHHHHH
wildharlequin (wildharlequin)
robots they're programmed to destroy us she's gotta be strong to fight them so she's taking lots of vitamins 'Cause she knows that it'd be tragic if those evil......
wildharlequin (wildharlequin)
robots they're programmed to destroy us she's gotta be strong to fight them so she's taking lots of vitamins 'Cause she knows that it'd be tragic if those evil......
extremelysnarky: Shaken not stirred. Homie.
The girl that made Kool Aid say "Oh yeah!" (extremelysnarky)
to keep track of our tangents), including but not limited to: driving, Vince Vaughn, prenatal vitamins, boys, Christina Ricci, and Seven Brides for Seven Brothers. Most importantly, we made and ...
The girl that made Kool Aid say "Oh yeah!" (extremelysnarky)
to keep track of our tangents), including but not limited to: driving, Vince Vaughn, prenatal vitamins, boys, Christina Ricci, and Seven Brides for Seven Brothers. Most importantly, we made and ...
keenmixer
Keen (keenmixer)
all day? Very frustrating. Anywho...feel like my emotions are coming somewhat back into balance. The vitamins probably help, as well as my reminder to myself to just be honest. With everyone....
Keen (keenmixer)
all day? Very frustrating. Anywho...feel like my emotions are coming somewhat back into balance. The vitamins probably help, as well as my reminder to myself to just be honest. With everyone....
freax_inc_punk
jesse (freax_inc_punk)
shivers you get when you have to go badly and yeah...............i hope you had your vitamins today....cause if you didnt your going to die of malnutrition.....im sorry but someone had ...
jesse (freax_inc_punk)
shivers you get when you have to go badly and yeah...............i hope you had your vitamins today....cause if you didnt your going to die of malnutrition.....im sorry but someone had ...
egotospend: Who Knows Where the Time Goes?
Son of Yank (egotospend)
Frank, Lockheed briefing on September 1st, school starts next week, I'd better take my vitamins. I'd be better off in the morning if I got up at 5 a.m....
Son of Yank (egotospend)
Frank, Lockheed briefing on September 1st, school starts next week, I'd better take my vitamins. I'd be better off in the morning if I got up at 5 a.m....
chaltier: hosts? anyone?
chaltier (chaltier)
vitamins. Havnt been eating rice or anything similar for about 2 weeks. Currently on a diet...
chaltier (chaltier)
vitamins. Havnt been eating rice or anything similar for about 2 weeks. Currently on a diet...
shirleyapple: thick headed bitches
shirleyapple (shirleyapple)
ill at least have good reason to fall into school like no other. im taking vitamins and cocktails. i dont make sence and today is the first day i dont ...
shirleyapple (shirleyapple)
ill at least have good reason to fall into school like no other. im taking vitamins and cocktails. i dont make sence and today is the first day i dont ...
crashoverride13: Condoms
Jeff (crashoverride13)
the right one baby Pringles Condoms: Once you pop you can't stop Mentos Condoms: The freshmaker Flinstones Vitamins Condoms Pack: Ten million and growing strong Secret Condoms: Strong enough for a man, pH balanced...
Jeff (crashoverride13)
the right one baby Pringles Condoms: Once you pop you can't stop Mentos Condoms: The freshmaker Flinstones Vitamins Condoms Pack: Ten million and growing strong Secret Condoms: Strong enough for a man, pH balanced...
welldaaaanguh: no fucking subject
welldaaaanguh (welldaaaanguh)
i got a package from my dad in the mail but it was only like vitamins/printer cartridges nothing excited. and then i came home and did greek lessons and drew ...
welldaaaanguh (welldaaaanguh)
i got a package from my dad in the mail but it was only like vitamins/printer cartridges nothing excited. and then i came home and did greek lessons and drew ...
surrender_404: another headaches, another heartbreaks
surrender_404 (surrender_404)
on a diet of coffee and PB&J sandwiches will do that to you. I took vitamins, what's the big deal? So, we had a rockin' show last night. There was supposed ...
surrender_404 (surrender_404)
on a diet of coffee and PB&J sandwiches will do that to you. I took vitamins, what's the big deal? So, we had a rockin' show last night. There was supposed ...
peaches321: A state of something...
Peaches (peaches321)
why, but I'm sick as per usual stress-till-i-actually-come-down-with-something mode running through me. I'm taking vitamins but as of i didn't start till a few days ago I doubt they'll kick...
Peaches (peaches321)
why, but I'm sick as per usual stress-till-i-actually-come-down-with-something mode running through me. I'm taking vitamins but as of i didn't start till a few days ago I doubt they'll kick...
trishie9498: A Supermarket Drugstore
trishie9498 (trishie9498)
that sells medicine of all kinds (including traditional Chinese medicine), health care products like vitamins and supplements, along with doctors on site providing free medical advice. That wasn't the...
trishie9498 (trishie9498)
that sells medicine of all kinds (including traditional Chinese medicine), health care products like vitamins and supplements, along with doctors on site providing free medical advice. That wasn't the...
authenticthreds
Rebecca Lowell (authenticthreds)
wash, slept a lot, dosed myself with copious amounts of sudephed and consumed enough vitamins to dose a large farm animal... and now I'm on the mend. Just some residual...
Rebecca Lowell (authenticthreds)
wash, slept a lot, dosed myself with copious amounts of sudephed and consumed enough vitamins to dose a large farm animal... and now I'm on the mend. Just some residual...
pyrosinferno: Canto 89: A Series of Unfortunate Events
pyrosinferno (pyrosinferno)
fuck. (2) got the flu for the nth time this semester. i swear i am taking vitamins next sem. (3)......
pyrosinferno (pyrosinferno)
fuck. (2) got the flu for the nth time this semester. i swear i am taking vitamins next sem. (3)......
whipp
Wh|p (whipp)
today cause I'm afraid its going to make me cough more =( grrr poppen the vitamins and been drinking OJ and water like its going out of style. I think ...
Wh|p (whipp)
today cause I'm afraid its going to make me cough more =( grrr poppen the vitamins and been drinking OJ and water like its going out of style. I think ...
deadkytty9
deadkytty9 (deadkytty9)
up and we hung out for awhile, went to the pet store for guinea pig vitamins, got cheese and cokes at HEB, made hamburgers (I'm turning into quite the ground ...
deadkytty9 (deadkytty9)
up and we hung out for awhile, went to the pet store for guinea pig vitamins, got cheese and cokes at HEB, made hamburgers (I'm turning into quite the ground ...
letters2nick: .....I'll do anything.......
letters2nick (letters2nick)
on't know. Maybe I'm being hormonal or something because I have to take these damned vitamins to make me feel better instead of aching everyday and morning...but still... is it ...
letters2nick (letters2nick)
on't know. Maybe I'm being hormonal or something because I have to take these damned vitamins to make me feel better instead of aching everyday and morning...but still... is it ...
stariniteeyes: Hmmm
just a touch of sadness... (stariniteeyes)
it. I don't want to take anything i have for grandted. I have been taking vitamins thinking......
just a touch of sadness... (stariniteeyes)
it. I don't want to take anything i have for grandted. I have been taking vitamins thinking......
adri_nwnderland
adri_nwnderland (adri_nwnderland)
electronics pc materials little kleenex packets toiletries (here's to hoping they don't explode onto laptop and other electronics) vitamins a change of undies in case other bag is lost. photos of home jewelry, hair clips etc. Purse couple of...
adri_nwnderland (adri_nwnderland)
electronics pc materials little kleenex packets toiletries (here's to hoping they don't explode onto laptop and other electronics) vitamins a change of undies in case other bag is lost. photos of home jewelry, hair clips etc. Purse couple of...
shinkashei: fun with hospitals
ashanti (shinkashei)
to an end the day that i had to finally know why it was all happening. prenatal vitamins they contain more iron than your typical female vitamins i have been taking them the past ...
ashanti (shinkashei)
to an end the day that i had to finally know why it was all happening. prenatal vitamins they contain more iron than your typical female vitamins i have been taking them the past ...
sertok
Eric Christopher (sertok)
enjoying seeing davonne in the quad vanessa made a very pleasant, decadent, candlelit dinner with vitamins and music for us tonight. what a class act. yesterday was labor day, so it...
Eric Christopher (sertok)
enjoying seeing davonne in the quad vanessa made a very pleasant, decadent, candlelit dinner with vitamins and music for us tonight. what a class act. yesterday was labor day, so it...
syntax_o
Jeff (syntax_o)
us in his cool Honda. We shopped around. I didn't purchase anything other than some multi-vitamins, so I can be all full of......
Jeff (syntax_o)
us in his cool Honda. We shopped around. I didn't purchase anything other than some multi-vitamins, so I can be all full of......
finallywoken: everything is everything
Ceji (finallywoken)
my Lauryn Hill CD! I'm so excited over that too. Excitement abounds! Started my vitamins earlier this week actually. I feel like I'm sick with all the pills I'm tak...
Ceji (finallywoken)
my Lauryn Hill CD! I'm so excited over that too. Excitement abounds! Started my vitamins earlier this week actually. I feel like I'm sick with all the pills I'm tak...
rummyredhead
That Girl (rummyredhead)
you've got a complete experience. Going for a cup of tea, now, to wash down my vitamins. :D......
That Girl (rummyredhead)
you've got a complete experience. Going for a cup of tea, now, to wash down my vitamins. :D......
gummisteph: i'm feeling sick..ech
gummisteph (gummisteph)
give me their math skills for about four hours? Grr. I plan on relaxing, taking vitamins and getting plenty of yummy food tonight and tomorrow, then its back on the ...
gummisteph (gummisteph)
give me their math skills for about four hours? Grr. I plan on relaxing, taking vitamins and getting plenty of yummy food tonight and tomorrow, then its back on the ...
annegwish33: So....
annegwish33 (annegwish33)
Just to preserve my mom's sanity... *Only one snack per day. Under 150 calories. *Take vitamins every day. *Do simple stretches and exercises when......
annegwish33 (annegwish33)
Just to preserve my mom's sanity... *Only one snack per day. Under 150 calories. *Take vitamins every day. *Do simple stretches and exercises when......
matthewjr: Health honework and god knows what
matthewjr (matthewjr)
I took 2 bike rides today, did situps and started back on the supplements/vitamins regimen. Last time I did this I got within 15 lbs of where I...
matthewjr (matthewjr)
I took 2 bike rides today, did situps and started back on the supplements/vitamins regimen. Last time I did this I got within 15 lbs of where I...
everlong84: oh gosh
everlong84 (everlong84)
Before my alarm ?! Been shopping to Bridgend. I bought: A white top from Top-Shop. A black headband. Some Multi-vitamins. Some gel cushions for my feet (I have now, however, realised......
everlong84 (everlong84)
Before my alarm ?! Been shopping to Bridgend. I bought: A white top from Top-Shop. A black headband. Some Multi-vitamins. Some gel cushions for my feet (I have now, however, realised......
lovelybones11 (in purge_it_away): fruit + veggie diet
....// (lovelybones11)
with you in these sorts of things. and if you do, make sure you take your vitamins. x-posted......
....// (lovelybones11)
with you in these sorts of things. and if you do, make sure you take your vitamins. x-posted......
ameliorateme: you're getting good at looking like you want to take me back
Laura Horon (ameliorateme)
vitamins. Random parts of my body are starting to ache, sometimes unbearably. I've been breaking out...
Laura Horon (ameliorateme)
vitamins. Random parts of my body are starting to ache, sometimes unbearably. I've been breaking out...
bleepbleeplove: [ burning calories ]
bleepbleeplove (bleepbleeplove)
.........head....... massages the jaw....while burning 32 calories.Swallowing foreign body juices is actually like taking vitamins and it whitens your teethHaving nice sex burnes 358 calories.Having rough sex [make it hurt]...
bleepbleeplove (bleepbleeplove)
.........head....... massages the jaw....while burning 32 calories.Swallowing foreign body juices is actually like taking vitamins and it whitens your teethHaving nice sex burnes 358 calories.Having rough sex [make it hurt]...
__pickrollflick: my new workout plan
Jo. (__pickrollflick)
.........head....... massages the jaw....while burning 32 calories. Swallowing foreign body juices is actually like taking vitamins and it whitens your teeth Having nice sex burns 358 calories. Having rough sex [make it hurt]...
Jo. (__pickrollflick)
.........head....... massages the jaw....while burning 32 calories. Swallowing foreign body juices is actually like taking vitamins and it whitens your teeth Having nice sex burns 358 calories. Having rough sex [make it hurt]...
somacoma87: lets pretend were born as innocents
somacoma87 (somacoma87)
heartbeat, and i want to share his body heat. im so drained, i should probably take vitamins.i brought some of my notebooks which are filled with journal entries and i contemplated ...
somacoma87 (somacoma87)
heartbeat, and i want to share his body heat. im so drained, i should probably take vitamins.i brought some of my notebooks which are filled with journal entries and i contemplated ...
victory_march: Nevermind.
victory_march (victory_march)
can have some more. The water is so yellow, I'm a healthy student, you're my vitamins. Take your time, hurry up, the choice is yours, don't be late. And just ...
victory_march (victory_march)
can have some more. The water is so yellow, I'm a healthy student, you're my vitamins. Take your time, hurry up, the choice is yours, don't be late. And just ...
indigobull5783: we played dress up!!
indigobull5783 (indigobull5783)
interesting. I found out that my iron levels are low and have begun taking vitamins, because I'm really enjoying that extra $50 a week so I gotta keep my ...
indigobull5783 (indigobull5783)
interesting. I found out that my iron levels are low and have begun taking vitamins, because I'm really enjoying that extra $50 a week so I gotta keep my ...
thisisnotemily
Em (thisisnotemily)
Japanese so she's translating. That's so awesome. ClaytonRoxMiSox: Did you know Missy has Justice League vitamins? SunouEiesu: Yes SunouEiesu: I have eaten some SunouEiesu: as well as the justice league popsicals SunouEiesu: i got ...
Em (thisisnotemily)
Japanese so she's translating. That's so awesome. ClaytonRoxMiSox: Did you know Missy has Justice League vitamins? SunouEiesu: Yes SunouEiesu: I have eaten some SunouEiesu: as well as the justice league popsicals SunouEiesu: i got ...
scarwithin
Tara-Louise (scarwithin)
vitamins. Im trying to become a healthier, better person. Ive been adding hours at work. I...
Tara-Louise (scarwithin)
vitamins. Im trying to become a healthier, better person. Ive been adding hours at work. I...
beth66203: Chinese Horrorscope for Dragons.....
beth66203 (beth66203)
of sorts and tired; it will be in your interest to make a cure of vitamins and trace elements in order to better resist microbic and viral attacks. This climate ...
beth66203 (beth66203)
of sorts and tired; it will be in your interest to make a cure of vitamins and trace elements in order to better resist microbic and viral attacks. This climate ...
minnesota_fats
minnesota_fats (minnesota_fats)
my alcohol with orange juice in a feeble attempt to replenish some of my depleted vitamins.u Amanda was around for a while tonight. I am contented. :)......
minnesota_fats (minnesota_fats)
my alcohol with orange juice in a feeble attempt to replenish some of my depleted vitamins.u Amanda was around for a while tonight. I am contented. :)......
greatestvitamin: first day
greatestvitamin (greatestvitamin)
vitamins today. I didn't start taking them until the afternoon so I took 1 at lunch...
greatestvitamin (greatestvitamin)
vitamins today. I didn't start taking them until the afternoon so I took 1 at lunch...
pharmapsycho
Viivi Creep (pharmapsycho)
I'm so damn tired and blank all the time.It's probably nothing more than lack of vitamins and calcium. Oh, a commercial directed by my brother is on (finnish) TV right now.Some ...
Viivi Creep (pharmapsycho)
I'm so damn tired and blank all the time.It's probably nothing more than lack of vitamins and calcium. Oh, a commercial directed by my brother is on (finnish) TV right now.Some ...
happyponyparade: i feel sick
Teresa (happyponyparade)
italy for 2 weeks i must be there every shift while he is away i will take vitamins and not drink fight the evil plague i have to go to a meeting at 3 ...
Teresa (happyponyparade)
italy for 2 weeks i must be there every shift while he is away i will take vitamins and not drink fight the evil plague i have to go to a meeting at 3 ...
nik_rofeelya: Last butt not least
nik rofeelya (nik_rofeelya)
be time for me to go to sleep. Final thoughts: Im really glad I have some B-12 vitamins. They will come in handy for my hangover before golf in the morning. Don Gibionni ...
nik rofeelya (nik_rofeelya)
be time for me to go to sleep. Final thoughts: Im really glad I have some B-12 vitamins. They will come in handy for my hangover before golf in the morning. Don Gibionni ...
brandywithay
Brandy (brandywithay)
sick. gross. everyone gets sick around here during the change of seasons. lesson: take your vitamins school officially runs my life, but since ive gotten......
Brandy (brandywithay)
sick. gross. everyone gets sick around here during the change of seasons. lesson: take your vitamins school officially runs my life, but since ive gotten......
eccequambonum: a moment of shallow gossip
EQB (eccequambonum)
to wish her such debilitating post-partum depression that she goes through all his flintstones vitamins and breaks his exercise bike and still manages to stab him repeatedly in the midst...
EQB (eccequambonum)
to wish her such debilitating post-partum depression that she goes through all his flintstones vitamins and breaks his exercise bike and still manages to stab him repeatedly in the midst...
jcfunk: before the sunrise
jcfunk (jcfunk)
it was called! haha, that makes me laugh everytime. also, got myself a bottle of vitamins. playing in st. louis......
jcfunk (jcfunk)
it was called! haha, that makes me laugh everytime. also, got myself a bottle of vitamins. playing in st. louis......
totallyluvable: Condom...... thing... lol
totallyluvable (totallyluvable)
the right one baby Pringles Condoms: Once you pop you can't stop Mentos Condoms: The freshmaker Flinstones Vitamins Condoms Pack: Ten million and growing strong Secret Condoms: Strong enough for a man, pH balanced...
totallyluvable (totallyluvable)
the right one baby Pringles Condoms: Once you pop you can't stop Mentos Condoms: The freshmaker Flinstones Vitamins Condoms Pack: Ten million and growing strong Secret Condoms: Strong enough for a man, pH balanced...
sweet_morbidity
Broken Bottles Under Childrens Feet (sweet_morbidity)
vitamins i'd turn into mush.......
Broken Bottles Under Childrens Feet (sweet_morbidity)
vitamins i'd turn into mush.......
lachicablanca: rough sex (lets do it!)
lachicablanca (lachicablanca)
multiply! Giving .........head....... massages the jaw....while burning 32 calories. Swallowing foreign body juices is actually like taking vitamins and it......
lachicablanca (lachicablanca)
multiply! Giving .........head....... massages the jaw....while burning 32 calories. Swallowing foreign body juices is actually like taking vitamins and it......
aliciak: Six day hospital stay (best lj entry EVER?)
Alicia (aliciak)
though I have a chronic disease that results in daily blood loss, malabsorption of vitamins, pain, discomfort, etc. You’d think logic would kick in! But no, I wait...
Alicia (aliciak)
though I have a chronic disease that results in daily blood loss, malabsorption of vitamins, pain, discomfort, etc. You’d think logic would kick in! But no, I wait...
lemonlye: Stuff stuff stuff
A Small Creature with Dark and Fiery Thoughts (lemonlye)
blood the body needs to make. This despite the heavy iron content in prenatal vitamins--iron that, in turn, may not be all that effective since it's in......
A Small Creature with Dark and Fiery Thoughts (lemonlye)
blood the body needs to make. This despite the heavy iron content in prenatal vitamins--iron that, in turn, may not be all that effective since it's in......
drumsngoldfish
kissthebombshell (drumsngoldfish)
get to Mark Twain and last night I vowed I need to eat healthy, take vitamins, etc because Ive felt like shit lately and oooooh nooo......
kissthebombshell (drumsngoldfish)
get to Mark Twain and last night I vowed I need to eat healthy, take vitamins, etc because Ive felt like shit lately and oooooh nooo......
lightgirlfx: my dad
lightgirlfx (lightgirlfx)
vitamins,dha,synephrine,ginseng,ginger,green tea,kola nut,RHODIOLA ROSEA, not necessarily in that order.... to peel my brain open enough...
lightgirlfx (lightgirlfx)
vitamins,dha,synephrine,ginseng,ginger,green tea,kola nut,RHODIOLA ROSEA, not necessarily in that order.... to peel my brain open enough...
amr_jr48: Good Afternoon!
amr_jr48 (amr_jr48)
(Lori's boss -I think- and friend from work) gave Tiffany $40 worth of prenatal vitamins. So that was really nice of him. I am sooo excited about the baby. Except...
amr_jr48 (amr_jr48)
(Lori's boss -I think- and friend from work) gave Tiffany $40 worth of prenatal vitamins. So that was really nice of him. I am sooo excited about the baby. Except...
grantaclause
Grant (grantaclause)
r eating all those Number Three Extra value Meals at Mac Donalds Biggie Fries, Biggie Drink Lack of vitamins and minerals makes the health sink To levels unsuitable for man, woman, child Or the Beasts ...
Grant (grantaclause)
r eating all those Number Three Extra value Meals at Mac Donalds Biggie Fries, Biggie Drink Lack of vitamins and minerals makes the health sink To levels unsuitable for man, woman, child Or the Beasts ...
rockstarbaby_ak: funny.......
Lexi (rockstarbaby_ak)
shower. Use face cloth, long loofah, pumice stone. Wash you hair twice with shampoo plus 43 added vitamins. Condition hair with grapefruit/mint enhanced conditioner. Wash your face with crushed apricot facial scrub for 10 ...
Lexi (rockstarbaby_ak)
shower. Use face cloth, long loofah, pumice stone. Wash you hair twice with shampoo plus 43 added vitamins. Condition hair with grapefruit/mint enhanced conditioner. Wash your face with crushed apricot facial scrub for 10 ...
characternamee
Gabriel (characternamee)
Vitamins, Brushing your teeth, and the alphabet. I found the Gallery to be hilarious (Also the...
Gabriel (characternamee)
Vitamins, Brushing your teeth, and the alphabet. I found the Gallery to be hilarious (Also the...
rubyrx7: So very tired
rubyrx7 (rubyrx7)
is sleep. I don't know what is wrong with me..... I think that i need to take vitamins or something.... Well I had a great time with foolishgirl5239, Jax, Noe, and momma2. We ...
rubyrx7 (rubyrx7)
is sleep. I don't know what is wrong with me..... I think that i need to take vitamins or something.... Well I had a great time with foolishgirl5239, Jax, Noe, and momma2. We ...
soapboxer: weekend warrior..
pretty punchy in pink (soapboxer)
i hot chocolate. i'm yawning a lot more which means it's time i start taking vitamins and better care of myself. i feel like 8 hours of sleep isn't enough ...
pretty punchy in pink (soapboxer)
i hot chocolate. i'm yawning a lot more which means it's time i start taking vitamins and better care of myself. i feel like 8 hours of sleep isn't enough ...
christiepooh: My review for Blog Topic #6
christiepooh (christiepooh)
a side dish. The packaging claims it is a good source of calcium and four vitamins. They have no trans fats or cholesterol but a whopping 36 grams of carbs. ...
christiepooh (christiepooh)
a side dish. The packaging claims it is a good source of calcium and four vitamins. They have no trans fats or cholesterol but a whopping 36 grams of carbs. ...
silvercrank: my hands are cold
silvercrank (silvercrank)
get cold, if i eat or drink anything hot i get hot...i need to take vitamins and cayenne supplements and i need to eat healthier. but i have no ...
silvercrank (silvercrank)
get cold, if i eat or drink anything hot i get hot...i need to take vitamins and cayenne supplements and i need to eat healthier. but i have no ...
dauntingthougt: weight
dauntingthougt (dauntingthougt)
some great progress with my weight loss. I still need to figure out what vitamins to take for my skin. I'm lucky to be alone at work today. Don't ha...
dauntingthougt (dauntingthougt)
some great progress with my weight loss. I still need to figure out what vitamins to take for my skin. I'm lucky to be alone at work today. Don't ha...
allergeist: vitamins L, S, and D
helter skelter (allergeist)
going to camp out in the mojave dessert for two days, with plenty of proper vitamins and skies filled with lucy and diamonds. then vegoose. on halloween night the (remaining) ...
helter skelter (allergeist)
going to camp out in the mojave dessert for two days, with plenty of proper vitamins and skies filled with lucy and diamonds. then vegoose. on halloween night the (remaining) ...
sherriemg: The mortification sets in
sherriemg (sherriemg)
need to get on some serious meds asap or maybe just take a lot of vitamins and exercise like Tom Cruise says. They were really cool about it and ...
sherriemg (sherriemg)
need to get on some serious meds asap or maybe just take a lot of vitamins and exercise like Tom Cruise says. They were really cool about it and ...
kitty_astoria: So pretty fucking much.
x[ASHLEY]x (kitty_astoria)
get to start the birthcontrol on Sunday. I am really bad about taking my vitamins everyday. I hope I don't fuck this up. :\ Oh. And the doctor gave ...
x[ASHLEY]x (kitty_astoria)
get to start the birthcontrol on Sunday. I am really bad about taking my vitamins everyday. I hope I don't fuck this up. :\ Oh. And the doctor gave ...
yourjustswell
Kat (yourjustswell)
my mom is gonna help me figure out how to get all the amino acids, vitamins, minerals, all the healthy stuff in since shes a dietician....im not 100 percent sure ...
Kat (yourjustswell)
my mom is gonna help me figure out how to get all the amino acids, vitamins, minerals, all the healthy stuff in since shes a dietician....im not 100 percent sure ...
baffledportrait
Jamie (baffledportrait)
the entire time (plus, I only have one today, the rest are cancelled! odd.) Take your vitamins children! Don't get sick like me.......
Jamie (baffledportrait)
the entire time (plus, I only have one today, the rest are cancelled! odd.) Take your vitamins children! Don't get sick like me.......
electraisha
Aisha (electraisha)
some applejuice like I always have when I feel sick, hopefully a good dose of vitamins will help.......
Aisha (electraisha)
some applejuice like I always have when I feel sick, hopefully a good dose of vitamins will help.......
ammonoid
Kate (ammonoid)
over the place. I've also been sleeping a lot. Tonight! More sleep, more vitamins. Exciting. Oh and I bought some pants today. PANTS.......
Kate (ammonoid)
over the place. I've also been sleeping a lot. Tonight! More sleep, more vitamins. Exciting. Oh and I bought some pants today. PANTS.......
_sketchy: still ok
sketchy (_sketchy)
inbed. she kept all her food from yesterday down - lots of small meals and some vitamins.......
sketchy (_sketchy)
inbed. she kept all her food from yesterday down - lots of small meals and some vitamins.......
mistyfoxy: Yay..
That bad little fox.. (mistyfoxy)
organic vegetables combined with some sort of organic chicken or something. Gotta get some vitamins somehow, and Cat always makes sure I get them. She looks after me in every...
That bad little fox.. (mistyfoxy)
organic vegetables combined with some sort of organic chicken or something. Gotta get some vitamins somehow, and Cat always makes sure I get them. She looks after me in every...
jellyfish1286 (in effexor_drama): Celexa withdrawal
Jellyfish (jellyfish1286)
celexa, my questions are: how long did you feel withdrawal for, and is there anything (vitamins and such) that will help with the symptoms? Thanks!!!......
Jellyfish (jellyfish1286)
celexa, my questions are: how long did you feel withdrawal for, and is there anything (vitamins and such) that will help with the symptoms? Thanks!!!......
imjustduckie: Your Daily Duckie 11/10/05
imjustduckie (imjustduckie)
maybe I just kept hearing about drinking 12oz glasses of such-and-such to get your vitamins in that drink or...who knows really. Anyway, somehow I had it in my head...
imjustduckie (imjustduckie)
maybe I just kept hearing about drinking 12oz glasses of such-and-such to get your vitamins in that drink or...who knows really. Anyway, somehow I had it in my head...
ignorantusa
ignorantusa (ignorantusa)
and when I need to make a trip to whole foods for rice crackers and vitamins. Looking for cigarettes that arn't quite as bad for me as this deathly "Newports" ...
ignorantusa (ignorantusa)
and when I need to make a trip to whole foods for rice crackers and vitamins. Looking for cigarettes that arn't quite as bad for me as this deathly "Newports" ...
2wrong2bwrite: some thoughts
2wrong2bwrite (2wrong2bwrite)
about me.. thinking that i DO deserve friends... thinking that i need to start taking my multi vitamins... thinking that i'm sinking again... thinking that i could just cry at anytime... thinking ..why can't i ...
2wrong2bwrite (2wrong2bwrite)
about me.. thinking that i DO deserve friends... thinking that i need to start taking my multi vitamins... thinking that i'm sinking again... thinking that i could just cry at anytime... thinking ..why can't i ...
gernblanston12: Hello my Onions
gernblanston12 (gernblanston12)
over to party. She said she would provide the alcohol and drugs, tinfoil, Flinstone's vitamins, whatever they're into, but she would provide it as long as she could hang out...
gernblanston12 (gernblanston12)
over to party. She said she would provide the alcohol and drugs, tinfoil, Flinstone's vitamins, whatever they're into, but she would provide it as long as she could hang out...
something_jive: commercial stupidity
[Complicated Answer] (something_jive)
how lenscrafters intends to guarantee my unconditional happiness. I was enticed with the promise of vitamins. The acid part was less forthcoming. then more. oh well. Positive...
[Complicated Answer] (something_jive)
how lenscrafters intends to guarantee my unconditional happiness. I was enticed with the promise of vitamins. The acid part was less forthcoming. then more. oh well. Positive...
jesse_rizzay
Jesse_Rizzay (jesse_rizzay)
poland spring:x: favorite burger place: mcdonalds:x: favorite friends: hellllloooo the stick click of course:x: favorite vitamins: flinstones:x: favorite show: prison break/law and order/seinfeld:x: favorite news: i dont......
Jesse_Rizzay (jesse_rizzay)
poland spring:x: favorite burger place: mcdonalds:x: favorite friends: hellllloooo the stick click of course:x: favorite vitamins: flinstones:x: favorite show: prison break/law and order/seinfeld:x: favorite news: i dont......
shrinking_me: well....
Chrissy (shrinking_me)
thing seriously, and life has been downhill since then weigh-in: 190.4 point range: 24 flex points: --- water: -- oz vitamins: -- AP's earned: -- blueberry muffins - 2 glass of milk - 3 total: 5......
Chrissy (shrinking_me)
thing seriously, and life has been downhill since then weigh-in: 190.4 point range: 24 flex points: --- water: -- oz vitamins: -- AP's earned: -- blueberry muffins - 2 glass of milk - 3 total: 5......
im_falling_in (in julybabies2006)
im_falling_in (im_falling_in)
doc if he can give me a prescription for them. I absolutely hate taking these vitamins. Any pill going down my throat lately makes me gag. crossposted......
im_falling_in (im_falling_in)
doc if he can give me a prescription for them. I absolutely hate taking these vitamins. Any pill going down my throat lately makes me gag. crossposted......
journeytoself: today's records
journeytoself (journeytoself)
r i suppose but didn't do any exercise other than sex with Tivon. didn't take vitamins. i was so upset. i was thinking about Damien and Freddy and the whole ...
journeytoself (journeytoself)
r i suppose but didn't do any exercise other than sex with Tivon. didn't take vitamins. i was so upset. i was thinking about Damien and Freddy and the whole ...
follow_the_rain
Michelle (follow_the_rain)
for fast food :x: favorite hobby: hah who has the time :x: bar or club: bar :x: favorite vitamins: im sick of pills :x: favorite shows:......
Michelle (follow_the_rain)
for fast food :x: favorite hobby: hah who has the time :x: bar or club: bar :x: favorite vitamins: im sick of pills :x: favorite shows:......
emyloua
emyloua (emyloua)
My skin is bruised in a bunch of places. I guess lack of vitamins and nutrients and being careless is causing it. I hate feeling this way......
emyloua (emyloua)
My skin is bruised in a bunch of places. I guess lack of vitamins and nutrients and being careless is causing it. I hate feeling this way......
jamietw: OK last time you will have to hear about this I promise:)
Jamie (jamietw)
commong offf. I told my dr. at my 3 day check up that I switched vitamins to gummy vites because Flinstone vites taste like ass. He said no prob. So ...
Jamie (jamietw)
commong offf. I told my dr. at my 3 day check up that I switched vitamins to gummy vites because Flinstone vites taste like ass. He said no prob. So ...
oliviahoney
no name yet. (oliviahoney)
vitamins. drink one more pint of water. eat one fruit. drink one danactiv. wash my face. use toner and lotion. apply deoderant. dress...
no name yet. (oliviahoney)
vitamins. drink one more pint of water. eat one fruit. drink one danactiv. wash my face. use toner and lotion. apply deoderant. dress...
idiotrule: proof i don't eat crap ALL THE TIME. and other stuff.
THE AFTERTHOUGHT (idiotrule)
of water (throughout the day) another carrot, some cherry tomatoes, and an apple (snack) oliveses stuffed with pimento. OJ. vitamins. tic tacs. Occasionally: mcdonald's apple pie. sweeties. Weekends: double chocolate chip pancakes (breakfast) onion rings (yum x 10^23) aborted foeti. Stuff I did ...
THE AFTERTHOUGHT (idiotrule)
of water (throughout the day) another carrot, some cherry tomatoes, and an apple (snack) oliveses stuffed with pimento. OJ. vitamins. tic tacs. Occasionally: mcdonald's apple pie. sweeties. Weekends: double chocolate chip pancakes (breakfast) onion rings (yum x 10^23) aborted foeti. Stuff I did ...
rhealistic: wow..is cold
rhea (rhealistic)
starbucks..cause its 24 hours!!!! i'm so addicted to caffeine.. work is work i've been taking vitamins and doing tae-bo i want to dye my hair i still need to do ALL my x-mas...
rhea (rhealistic)
starbucks..cause its 24 hours!!!! i'm so addicted to caffeine.. work is work i've been taking vitamins and doing tae-bo i want to dye my hair i still need to do ALL my x-mas...
emptyxhearts
DOLLY (emptyxhearts)
everything together, wishing everyone happy holidays and a safe drive home. i've been taking daily vitamins because i believe i am unhealthy,......
DOLLY (emptyxhearts)
everything together, wishing everyone happy holidays and a safe drive home. i've been taking daily vitamins because i believe i am unhealthy,......
dismal_love: I love fasting!!
dismal_love (dismal_love)
reay well it's only been two days and all i've had is water and multi vitamins and i feel soo good. I can really see a difference in my face ...
dismal_love (dismal_love)
reay well it's only been two days and all i've had is water and multi vitamins and i feel soo good. I can really see a difference in my face ...
revolver_koala (in teamccr): Public service announcement
Bokusatsu Tenshi RK (revolver_koala)
wall.gif not only has the great taste kids love, but is fortified with nine essential vitamins and minerals......
Bokusatsu Tenshi RK (revolver_koala)
wall.gif not only has the great taste kids love, but is fortified with nine essential vitamins and minerals......
paulstus: Ye Olde Solstice
Paul (paulstus)
my Christmas/Birthday Wish List. -- A used/cheap satchel, preferably with magical "Bag of Holding" properties -- Vitamins -- Food--Morning Star Farms, etc. -- The Bela Lugosi Collection DVD (5 movies, including "The Black Cat"...
Paul (paulstus)
my Christmas/Birthday Wish List. -- A used/cheap satchel, preferably with magical "Bag of Holding" properties -- Vitamins -- Food--Morning Star Farms, etc. -- The Bela Lugosi Collection DVD (5 movies, including "The Black Cat"...
hugskitties19: Inhaler, anyone?
irish and buzzing happily (hugskitties19)
Lying down felt good. And of course, I’ve been routinely dosing up with vitamins and immune boosters every 4 hours like I’m supposed to. So far, I’ve ...
irish and buzzing happily (hugskitties19)
Lying down felt good. And of course, I’ve been routinely dosing up with vitamins and immune boosters every 4 hours like I’m supposed to. So far, I’ve ...
beautifulcorpse
Ann (beautifulcorpse)
get her clothes, so she's practically swimming in mine. I gave her some prenatal vitamins and fed her. I'm at kind of a loss here. I can barely support myself...
Ann (beautifulcorpse)
get her clothes, so she's practically swimming in mine. I gave her some prenatal vitamins and fed her. I'm at kind of a loss here. I can barely support myself...
cathubodva (in adenomyosis)
Ash (cathubodva)
and treatments I've tried over the years have been with unconventional medicines - herbs, vitamins, etc. A lot of them didn't work, or obviously made things worse. I just learned,...
Ash (cathubodva)
and treatments I've tried over the years have been with unconventional medicines - herbs, vitamins, etc. A lot of them didn't work, or obviously made things worse. I just learned,...
jennycarson06: Today I ate....
jennycarson06 (jennycarson06)
vitamins 1 piece of johnny cake with 2 sausages and syrup (yes, my family does leftovers. ...
jennycarson06 (jennycarson06)
vitamins 1 piece of johnny cake with 2 sausages and syrup (yes, my family does leftovers. ...
ok_sure
ok_sure (ok_sure)
Before Bed Routine? _________ Quick Check List: color in the circles Meals X00 Fruits X00 Water 00000000 Vitamins X Snacks 000 Veggies 000 Milk Products 000 Walking 0 Weights 0 Aerobic Activity 0 Stretching......
ok_sure (ok_sure)
Before Bed Routine? _________ Quick Check List: color in the circles Meals X00 Fruits X00 Water 00000000 Vitamins X Snacks 000 Veggies 000 Milk Products 000 Walking 0 Weights 0 Aerobic Activity 0 Stretching......
lookintoaw: business start ups
lookintoaw (lookintoaw)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
lookintoaw (lookintoaw)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
nomorecupcakes: Day 3 (so far)
nomorecupcakes (nomorecupcakes)
tea tastes like ass but it's supposed to help. lots of agua 1 oz liquid vitamins (8 cals) 1 cup of black coffee 2 slices of pumpernickel toast, lightly buttered (bad!! ...
nomorecupcakes (nomorecupcakes)
tea tastes like ass but it's supposed to help. lots of agua 1 oz liquid vitamins (8 cals) 1 cup of black coffee 2 slices of pumpernickel toast, lightly buttered (bad!! ...
sperenza
Sophie (sperenza)
vitamins. I now have a cold. Now I'm going to work feeling like crap. I spent...
Sophie (sperenza)
vitamins. I now have a cold. Now I'm going to work feeling like crap. I spent...
gajewsls: dreams?
Laura Gajewski (gajewsls)
dream mom and grandma and i were trying to trick rachel and bob into taking vitamins because they were becoming over wieght and thier marriage was suffering for that reason. ...
Laura Gajewski (gajewsls)
dream mom and grandma and i were trying to trick rachel and bob into taking vitamins because they were becoming over wieght and thier marriage was suffering for that reason. ...
goldtreasures: Peter Paul Edible Virgin Coconut Oil
goldtreasures (goldtreasures)
Increases energy level enhancing physical and athletic performance Improves digestion and nutrient absorption of fat soluble vitamins and amino acids Increases Metabolism Helps lose weight Helps prevent osteoporpsis Keeps skin becomes soft and smooth Helps premature ...
goldtreasures (goldtreasures)
Increases energy level enhancing physical and athletic performance Improves digestion and nutrient absorption of fat soluble vitamins and amino acids Increases Metabolism Helps lose weight Helps prevent osteoporpsis Keeps skin becomes soft and smooth Helps premature ...
hydrographer687: Non Surgical Face Lift Strips
hydrographer687 (hydrographer687)
vitamins are then added to restore, nourish and replenish your skin cells the most effective antioxidants...
hydrographer687 (hydrographer687)
vitamins are then added to restore, nourish and replenish your skin cells the most effective antioxidants...
linnen: Okay
Linnen Potter (linnen)
like I was ready to die. Rachel, however, has been my hero. She gave me some vitamins and dayquil.......
Linnen Potter (linnen)
like I was ready to die. Rachel, however, has been my hero. She gave me some vitamins and dayquil.......
dvlf
viva (dvlf)
and they kept putting me on all that zoloft and shit..but most of these are vitamins so......
viva (dvlf)
and they kept putting me on all that zoloft and shit..but most of these are vitamins so......
xiaomao
Liz (xiaomao)
mushrooms and spinach help put everything into perspective. I'm sitting at home, hoping that vitamins and green things will help me feel less sick tomorrow. I actually got some work...
Liz (xiaomao)
mushrooms and spinach help put everything into perspective. I'm sitting at home, hoping that vitamins and green things will help me feel less sick tomorrow. I actually got some work...
chickadee2525: Almost Friday
Diedre (chickadee2525)
still nap for 2 hrs during the day. Its weird! Maybe I should start my vitamins again? I had more energy when......
Diedre (chickadee2525)
still nap for 2 hrs during the day. Its weird! Maybe I should start my vitamins again? I had more energy when......
mc_tri_log06
mc_tri_log06 (mc_tri_log06)
as a bit of a workout. And we ate a ton too. food journal: 11:45AM PB Sandwich; Vitamins 2:30PM Hot dog w/ chili & cheese, diet coke, tostitos 10:00PM Cheese Sticks, Bison burger, Ice ...
mc_tri_log06 (mc_tri_log06)
as a bit of a workout. And we ate a ton too. food journal: 11:45AM PB Sandwich; Vitamins 2:30PM Hot dog w/ chili & cheese, diet coke, tostitos 10:00PM Cheese Sticks, Bison burger, Ice ...
reprogmorphic: food n thoughts
reprogmorphic (reprogmorphic)
cayenne pepper 3 slices of grilled eggplant seasoned in garlic 1/2 carrot 3/4 zucchini 10 green beans 2x evening primrose vitamins tbsp of flaxseed's Other 2 litres of cranberry water 1 litre of filtered water Activity: None Impressions My plans for ...
reprogmorphic (reprogmorphic)
cayenne pepper 3 slices of grilled eggplant seasoned in garlic 1/2 carrot 3/4 zucchini 10 green beans 2x evening primrose vitamins tbsp of flaxseed's Other 2 litres of cranberry water 1 litre of filtered water Activity: None Impressions My plans for ...
aussiekris: one more quick note
Real Vets Don't Sleep (aussiekris)
Animal Production Systems (should be eye-opening) Veterinarians in Developing Nations and Biostatistics for Journal Readers (it's like taking vitamins: tastes chalky but it's good for you)......
Real Vets Don't Sleep (aussiekris)
Animal Production Systems (should be eye-opening) Veterinarians in Developing Nations and Biostatistics for Journal Readers (it's like taking vitamins: tastes chalky but it's good for you)......
renwick: Healthy foods/ funtional foods
Renwick Vel Eros (renwick)
and I've heard that it's pretty weird. It's fermented soy beans. It contains lots of vitamins (including B12 which is semi-rare in vegetable products and vitamin k2) and enzymes (such ...
Renwick Vel Eros (renwick)
and I've heard that it's pretty weird. It's fermented soy beans. It contains lots of vitamins (including B12 which is semi-rare in vegetable products and vitamin k2) and enzymes (such ...
estherita: i really enjoy flossing my teeth.
sleeping tubby (estherita)
do like it. like, eating fiber going running on unusually sunny/warm days in january fruits and vegetables taking vitamins cleaning &etc. i finished reading Freakonomics and then i finished reading Never Let Me Go which the best ...
sleeping tubby (estherita)
do like it. like, eating fiber going running on unusually sunny/warm days in january fruits and vegetables taking vitamins cleaning &etc. i finished reading Freakonomics and then i finished reading Never Let Me Go which the best ...
scarlet_sangria: Resistance is futile.
Kate Rose (scarlet_sangria)
vitamins like crazy, I think I may have a cold. I guess I can only hope...
Kate Rose (scarlet_sangria)
vitamins like crazy, I think I may have a cold. I guess I can only hope...
orangefae: If you are what you eat...
orangefae (orangefae)
much needed glass of orange juice to my soul. Refreshing and full of spiritual vitamins. And the more I see them the more excited I am about seeing them all...
orangefae (orangefae)
much needed glass of orange juice to my soul. Refreshing and full of spiritual vitamins. And the more I see them the more excited I am about seeing them all...
0_1jellyfish: Health Food Nuts Here
- (0_1jellyfish)
the deal with lj not keeping me logged in anymore? I've been tolerating taking vitamins lately when I never used to be able to because the niacin in them gave...
- (0_1jellyfish)
the deal with lj not keeping me logged in anymore? I've been tolerating taking vitamins lately when I never used to be able to because the niacin in them gave...
aimznemesis: Open your eeeyyyyyyyyyeeeesssssss
Teh Aimzinator (aimznemesis)
word of thanks* *APPROX. 2 SECONDS LATER........* Woman: "Excuse me, could you please tell me where the vitamins are?" (Hint: See below.) Me: *thinking* "Erm........" *is standing right in the......
Teh Aimzinator (aimznemesis)
word of thanks* *APPROX. 2 SECONDS LATER........* Woman: "Excuse me, could you please tell me where the vitamins are?" (Hint: See below.) Me: *thinking* "Erm........" *is standing right in the......
suprc
suprc (suprc)
vitamins with dinner and too much energy can't sleep. love steffie. want exercise bike. need to...
suprc (suprc)
vitamins with dinner and too much energy can't sleep. love steffie. want exercise bike. need to...
stephanie_bean: Um
Stephanie (stephanie_bean)
at self* I get pissed really easily lately. I need to go get them b vitamins things that are supposed to help you feel better and balance homrnoe levels. PHEW ...
Stephanie (stephanie_bean)
at self* I get pissed really easily lately. I need to go get them b vitamins things that are supposed to help you feel better and balance homrnoe levels. PHEW ...
tonks_kittygoth: Thanks
tonks_kittygoth (tonks_kittygoth)
wishes. I decided to wait on the physical therepy for a bit, and try taking my vitamins more regularly. (I read an artical in a wholistic healing book about tendinitis and ...
tonks_kittygoth (tonks_kittygoth)
wishes. I decided to wait on the physical therepy for a bit, and try taking my vitamins more regularly. (I read an artical in a wholistic healing book about tendinitis and ...
ruin_me: rip it like that
meow. (ruin_me)
vitamins, painting their insides blue and pink and red (because i don't have any other nail...
meow. (ruin_me)
vitamins, painting their insides blue and pink and red (because i don't have any other nail...
katndhat33: And it just hits you
Mark (katndhat33)
vitamins and my fish oil, eating a realativly healthy breakfast....I'm now on the verge of getting sick. Grumble......
Mark (katndhat33)
vitamins and my fish oil, eating a realativly healthy breakfast....I'm now on the verge of getting sick. Grumble......
pixel__love
pixel__love (pixel__love)
nothing has changed in those days/months. except i have a cold. cause i dress like autumn. oh well. EAT VITAMINS.......
pixel__love (pixel__love)
nothing has changed in those days/months. except i have a cold. cause i dress like autumn. oh well. EAT VITAMINS.......
fixnwrtr: God is dead
Passion Personified (fixnwrtr)
world is one where the act of going to the bathroom monitors the levels of vitamins, nutrients, sodium, etc. in your body and your food choices are limited by what ...
Passion Personified (fixnwrtr)
world is one where the act of going to the bathroom monitors the levels of vitamins, nutrients, sodium, etc. in your body and your food choices are limited by what ...
cariewolfe22: Im Still Here
cariewolfe22 (cariewolfe22)
reason I have been craving and enjoying greens. Most people say that I must need vitamins. 3: Soup. Always. 4: Beer. See above. 5: Blue sky. Its been around for a couple of ...
cariewolfe22 (cariewolfe22)
reason I have been craving and enjoying greens. Most people say that I must need vitamins. 3: Soup. Always. 4: Beer. See above. 5: Blue sky. Its been around for a couple of ...
orangebiscuit: day 11
orangebiscuit (orangebiscuit)
goal of 75 g.) 5 cups of water 16 oz each. (+1 for reaching 48 oz goal) vitamins (+ 1) exercise......
orangebiscuit (orangebiscuit)
goal of 75 g.) 5 cups of water 16 oz each. (+1 for reaching 48 oz goal) vitamins (+ 1) exercise......
wignersfriend: Bonehead activity or Why I should not be allowed to wake up before dawn.
Mr. Grok (wignersfriend)
vitamins. Right hand contents: open 2 liter bottle of root beer. Bonehead action: Pouring right hand into left...
Mr. Grok (wignersfriend)
vitamins. Right hand contents: open 2 liter bottle of root beer. Bonehead action: Pouring right hand into left...
athena_51: Jiggly Guts
DramaQueen (athena_51)
vitamins right now. I'm not sure this is a good combination. I feel jiggly. I was...
DramaQueen (athena_51)
vitamins right now. I'm not sure this is a good combination. I feel jiggly. I was...
fantasticbanana: Ten haiku
fantasticbanana (fantasticbanana)
have a show soon. I daydream of my paintings exchanged for dinner. Wellness I happen to have a shitload of vitamins I really should take. Artist's Etiquette Incessant belches go randomly unexcused. They are of longing. Mubblefubbles What I see in you is ...
fantasticbanana (fantasticbanana)
have a show soon. I daydream of my paintings exchanged for dinner. Wellness I happen to have a shitload of vitamins I really should take. Artist's Etiquette Incessant belches go randomly unexcused. They are of longing. Mubblefubbles What I see in you is ...
worththewords: pillz
worth the words (worththewords)
my new pill schedule. 8am - thyroid medication 9am - first dose of heart medication 1pm - vitamins 5pm - second dose of heart medication 7pm - insulin medication 9pm - allergy & birth control ...
worth the words (worththewords)
my new pill schedule. 8am - thyroid medication 9am - first dose of heart medication 1pm - vitamins 5pm - second dose of heart medication 7pm - insulin medication 9pm - allergy & birth control ...
zoieangel
Jen (zoieangel)
lot of normal food in their house...think goat cheese, goat milk, brown rice... beans and vitamins....so a pregnant woman who constantly eats is freaked out by this......
Jen (zoieangel)
lot of normal food in their house...think goat cheese, goat milk, brown rice... beans and vitamins....so a pregnant woman who constantly eats is freaked out by this......
flux_flux: healthy tips
flux_flux (flux_flux)
more than just your intestinal flora or probiotics (bifidus and acidophilus) but also the b- vitamins, including biotin and inositol, calcium, magnesium, iron and vitamin k. if you had to ...
flux_flux (flux_flux)
more than just your intestinal flora or probiotics (bifidus and acidophilus) but also the b- vitamins, including biotin and inositol, calcium, magnesium, iron and vitamin k. if you had to ...
unmalledover720: Insights on Overweight Children Percentage Liberty
unmalledover720 (unmalledover720)
vitamins and 4 essential minerals. Diet Pills Weight Loss Obesity Appetite Control ... pills, weight loss,...
unmalledover720 (unmalledover720)
vitamins and 4 essential minerals. Diet Pills Weight Loss Obesity Appetite Control ... pills, weight loss,...
lightraider: 10 days
Seth (lightraider)
limiting myself to raw fruits and vegetables for that time, along with herb tea, water, vitamins, barley green, and juice made from raw fruits and vegetables. It actually isn't too ...
Seth (lightraider)
limiting myself to raw fruits and vegetables for that time, along with herb tea, water, vitamins, barley green, and juice made from raw fruits and vegetables. It actually isn't too ...
yamirin: sleep problems? ~_~
Yami (yamirin)
morning and woke up about half past three... I wonder if I'm getting too much vitamins. though it's always weird to wake up when it's already dark outside... I guess ...
Yami (yamirin)
morning and woke up about half past three... I wonder if I'm getting too much vitamins. though it's always weird to wake up when it's already dark outside... I guess ...
smithsucks: Ok, Now what?
smithsucks (smithsucks)
meals on the run, lo-carb monster drinks because they're like crack, only fortified with B-vitamins! Top quality cereal with at least 15g of protein and fiber, boca, meatless riblets, ...
smithsucks (smithsucks)
meals on the run, lo-carb monster drinks because they're like crack, only fortified with B-vitamins! Top quality cereal with at least 15g of protein and fiber, boca, meatless riblets, ...
sarah_1026
sarah_1026 (sarah_1026)
something to eat Eat in room, salad and meat only ..... No snacks!!No stupid breakfast Take Pill everyday Take vitamins too Drink at least 8 bottles of water a day Take the inconvient route Dont straighten hair besides...
sarah_1026 (sarah_1026)
something to eat Eat in room, salad and meat only ..... No snacks!!No stupid breakfast Take Pill everyday Take vitamins too Drink at least 8 bottles of water a day Take the inconvient route Dont straighten hair besides...
umbridgesucks
Allieee (umbridgesucks)
wonderful to them. i mean she cleaned everything and gave them the best food and vitamins. well, after 4 1/2 years, one died last night :*( my mom is heartbroken. i think ...
Allieee (umbridgesucks)
wonderful to them. i mean she cleaned everything and gave them the best food and vitamins. well, after 4 1/2 years, one died last night :*( my mom is heartbroken. i think ...
galvanized_envy: Ack, the death is upon me...
galvanized_envy (galvanized_envy)
I have the perfect thing for the Black Plague, though....¡POWERADE! ¡Choc full of B Vitamins and keeps your body from shutting itself down! In the past three days I've tran...
galvanized_envy (galvanized_envy)
I have the perfect thing for the Black Plague, though....¡POWERADE! ¡Choc full of B Vitamins and keeps your body from shutting itself down! In the past three days I've tran...
discussionsabjr: Accident bike daytona week
discussionsabjr (discussionsabjr)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
discussionsabjr (discussionsabjr)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
gilove2dance: PD Day in the Morning
gilove2dance (gilove2dance)
then read my book until 10:01!! Then I had breakfast (oatmeal, milk, yogurt and vitamins) and came waltzing down to the computer. I have solo (lyrical, so exciting) ...
gilove2dance (gilove2dance)
then read my book until 10:01!! Then I had breakfast (oatmeal, milk, yogurt and vitamins) and came waltzing down to the computer. I have solo (lyrical, so exciting) ...
m_eclairier: so
m_eclairier (m_eclairier)
brain. i must be hormonal, or deprived of certain nutrients. i need to buy more vitamins. got a cool candle today for valentines. $85 dollars later. i have a test ...
m_eclairier (m_eclairier)
brain. i must be hormonal, or deprived of certain nutrients. i need to buy more vitamins. got a cool candle today for valentines. $85 dollars later. i have a test ...
thegreenaura: Blech
Kally (thegreenaura)
life I have been sleeping 8 (or more) hours a night, exercising regularly, taking my vitamins and avoiding sugar (weekends don't count!), but do I feel healthier? No, I'm sick. ...
Kally (thegreenaura)
life I have been sleeping 8 (or more) hours a night, exercising regularly, taking my vitamins and avoiding sugar (weekends don't count!), but do I feel healthier? No, I'm sick. ...
chibitoes
ANDI (chibitoes)
first doctors appointment is next monday. i will get an official due date and vitamins. brian wakes up in the middle of the night and rubs my belly......
ANDI (chibitoes)
first doctors appointment is next monday. i will get an official due date and vitamins. brian wakes up in the middle of the night and rubs my belly......
karsk: list
¤¤KARSK¤¤ (karsk)
*check* eat some lucky charms, have a glass of milk and vitamins *check* get back to the essay and insert references thus far ...
¤¤KARSK¤¤ (karsk)
*check* eat some lucky charms, have a glass of milk and vitamins *check* get back to the essay and insert references thus far ...
customsteelbuil: United states consumer debt
customsteelbuil (customsteelbuil)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
customsteelbuil (customsteelbuil)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
berts_yes: Find Green Tea Extract And Vitamins news and artic
berts_yes (berts_yes)
Vitamins Home About Us Contact Us Sitemap Navigation Green Tea Rheumatoid ArthritisIs Green Tea Better Than...
berts_yes (berts_yes)
Vitamins Home About Us Contact Us Sitemap Navigation Green Tea Rheumatoid ArthritisIs Green Tea Better Than...
laredo_regine: Vitamins to improve sperm morphology
laredo_regine (laredo_regine)
I do not know you very well, however I will search for something right about vitamins to improve sperm morphology and thanks god, I am going to discover it. Then ...
laredo_regine (laredo_regine)
I do not know you very well, however I will search for something right about vitamins to improve sperm morphology and thanks god, I am going to discover it. Then ...
linney
accident prone (linney)
met and he still likes me nonetheless a few days ago he convinced me to start taking vitamins that's a serious step.......
accident prone (linney)
met and he still likes me nonetheless a few days ago he convinced me to start taking vitamins that's a serious step.......
bewitching: How are those resolutions?
misty s. (bewitching)
Playing DDR like the dickens, eating breakfast/lunch/dinner every day, eating less+watching carbs, taking vitamins daily. Have begun to lose weight again despite feeling of eating all the time....
misty s. (bewitching)
Playing DDR like the dickens, eating breakfast/lunch/dinner every day, eating less+watching carbs, taking vitamins daily. Have begun to lose weight again despite feeling of eating all the time....
oxrockstarxo
heeps.is.beautiful. (oxrockstarxo)
do anything, I stayed home from work yesterday to O.D. on ginger ale & vitamins. I figure it's my best shot to get over whatever I got. I like t...
heeps.is.beautiful. (oxrockstarxo)
do anything, I stayed home from work yesterday to O.D. on ginger ale & vitamins. I figure it's my best shot to get over whatever I got. I like t...
wawwen_san: email
wawwen-san (wawwen_san)
vitamins? Have you been taking your vitamins? Don't lie. Love, mom......
wawwen-san (wawwen_san)
vitamins? Have you been taking your vitamins? Don't lie. Love, mom......
no_mo_tallow: Day Four of Eleven
Tallow Butt (no_mo_tallow)
coffee (0 crb), 2 packets Splenda (0 crb), 2 tbsp cream (2 crb). Breakfast sausage (0 crb). Vitamins: L-Lysine, Pre-natal. Midmorning Snack: (Total of 0 carbs) (skipped - too busy) Lunch: (Total 6 carbs) Water: 32 ...
Tallow Butt (no_mo_tallow)
coffee (0 crb), 2 packets Splenda (0 crb), 2 tbsp cream (2 crb). Breakfast sausage (0 crb). Vitamins: L-Lysine, Pre-natal. Midmorning Snack: (Total of 0 carbs) (skipped - too busy) Lunch: (Total 6 carbs) Water: 32 ...
stylevitality: Furnace filter 20 22
stylevitality (stylevitality)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
stylevitality (stylevitality)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
icanbemyself: Senarai khidmat negara 2006
icanbemyself (icanbemyself)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
icanbemyself (icanbemyself)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
thorkell: Mom and dad's trip to Cuba
Þorkell (thorkell)
her country considering all the stuff that's going on. They have bought all sorts of vitamins and pills and stuff, looks like they've robbed a pharmacy. Mom has also been ...
Þorkell (thorkell)
her country considering all the stuff that's going on. They have bought all sorts of vitamins and pills and stuff, looks like they've robbed a pharmacy. Mom has also been ...
xshelbellx: Vitamins...
Shel (xshelbellx)
vitamins that Lyssi&I bought at that new gas station on capehart like a month ago. And...
Shel (xshelbellx)
vitamins that Lyssi&I bought at that new gas station on capehart like a month ago. And...
gfnesselrode: Things My Cat Gets Excited About Because She Thinks They're Treats
universal bibliographic control (gfnesselrode)
Nuts lancets test strips syringes (she tries to take a bite while I'm giving her a shot) pens dried pasta cotton balls chocolate coins almonds vitamins anything else that's in a container and makes a noise She's not dumb, she's just optimistic!......
universal bibliographic control (gfnesselrode)
Nuts lancets test strips syringes (she tries to take a bite while I'm giving her a shot) pens dried pasta cotton balls chocolate coins almonds vitamins anything else that's in a container and makes a noise She's not dumb, she's just optimistic!......
beautyful_loser
beautyful_loser (beautyful_loser)
going on little walks to the donut shop for coffee at school. I started taking vitamins. I am really starting to feel better. Just in general. My mind is still ...
beautyful_loser (beautyful_loser)
going on little walks to the donut shop for coffee at school. I started taking vitamins. I am really starting to feel better. Just in general. My mind is still ...
forgivenessp271: Horse Infertility Solutions
forgivenessp271 (forgivenessp271)
can be difficult to find, but not when I hit this site - thanks. Fertility Vitamins For Men Urinary Tract Problems ... fertility vitamins for men urinary tract problems httpwwwmensvitaminsnetfertilityvitaminsformenurinarytractproblemshtm ...
forgivenessp271 (forgivenessp271)
can be difficult to find, but not when I hit this site - thanks. Fertility Vitamins For Men Urinary Tract Problems ... fertility vitamins for men urinary tract problems httpwwwmensvitaminsnetfertilityvitaminsformenurinarytractproblemshtm ...
jcorms: Bio 9 Essay
jcorms (jcorms)
vitamins, nutrients, proteins, etc. that the body needs on a daily basis, a diet based solely...
jcorms (jcorms)
vitamins, nutrients, proteins, etc. that the body needs on a daily basis, a diet based solely...
thedeathrockgrl
Charlotte (thedeathrockgrl)
vitamins, Bach flower essences, as much sleep as possible, and a visit from the best friend,...
Charlotte (thedeathrockgrl)
vitamins, Bach flower essences, as much sleep as possible, and a visit from the best friend,...
sexymonkeys: cigarettes and chocolate milk
Asma (sexymonkeys)
vitamins every day to prevent sleeping 12 fucking hours in a row without your consent. UGH. Eating...
Asma (sexymonkeys)
vitamins every day to prevent sleeping 12 fucking hours in a row without your consent. UGH. Eating...
valeris_hub: Freelance
valeris_hub (valeris_hub)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
valeris_hub (valeris_hub)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
verdas_hub: Safety
verdas_hub (verdas_hub)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
verdas_hub (verdas_hub)
supplements for me. There is just such a various choice of things. From vitamins and minerals, to chelated minerals, to whole food supplements, and all the various brands ...
drewb0y: i love reading
drewb0y (drewb0y)
I am now on page 540 and almost done. what to read next? Also been taking vitamins and trying to take care of myself somewhat...i wish my bike was in good ...
drewb0y (drewb0y)
I am now on page 540 and almost done. what to read next? Also been taking vitamins and trying to take care of myself somewhat...i wish my bike was in good ...
tsjocool: I'm not getting sick, I'm not getting sick
tsjocool (tsjocool)
vitamins and trying to stay away from K since she's been sick for almost a week...
tsjocool (tsjocool)
vitamins and trying to stay away from K since she's been sick for almost a week...
rebatosusten651: Low Dose Birth Control Pills And Acne
rebatosusten651 (rebatosusten651)
aughlin video statement submitted by admin on tue, 20050712 16 ... Save 45 on USANA Vitamins Skin Care Renew your spirit with USANA Sense Skin Care system. N. More info ...
rebatosusten651 (rebatosusten651)
aughlin video statement submitted by admin on tue, 20050712 16 ... Save 45 on USANA Vitamins Skin Care Renew your spirit with USANA Sense Skin Care system. N. More info ...
georgia_kiel: Primal Defense Supplement at Primal Defense
georgia_kiel (georgia_kiel)
Vitamins/supplements Lowest Prices! Garden of Life has what we believe are the finest vitamin and nutritional...
georgia_kiel (georgia_kiel)
Vitamins/supplements Lowest Prices! Garden of Life has what we believe are the finest vitamin and nutritional...
deathhasredlips: I need vitamins
Strange Girl (deathhasredlips)
deficincy that causes my immune system to be low. Amy gave me a list of vitamins that is good for helping me fight off every little germ that tries to ...
Strange Girl (deathhasredlips)
deficincy that causes my immune system to be low. Amy gave me a list of vitamins that is good for helping me fight off every little germ that tries to ...