Chocolate Chip Cookies
183 posts
monchichininjas: Cookies..monchichininjas (monchichininjas)chocolate chip cookies(the kind in the tube)after Ryan went to bed and put some in a...
smallelephantLiana (smallelephant)chocolate chip cookies together tonight...but...well, they turned into ghetto
chocolate chip cookies. we didnt have any...
cebraestupida: MuahaSteph (cebraestupida) was like...crap. We saw a Keith Urban cd at Target. It was happy. Umm. Umm. I made
chocolate chip cookies. With cake flour. It was an accident. I used the...
crazipete: Chocolate!crazipete (crazipete)chocolate and candy of all sorts! YUM! I just ate 2 giant gooey
chocolate chip cookies! Delicious! Today was fun. Saw Seth, Clint and Stephanie's play. ...
stoneysizzle: !happy happy joy joy!Heather (stoneysizzle)didnt get to talk to my buddy tommy which sucked so i made my famous
chocolate chip cookies at like 1 this morning. Read some of the new harry potter! ...
t_spoonert_spooner (t_spooner)chocolate chip cookies 1 medium french silk pie blizzard 1 revello pooped small hard balls like baby fists. not too messy......
peggasus: Still Monday...peggasus (peggasus)what else happened at work - walked round town for an hour - brought some
chocolate chip cookies - yum yum... and pretty much just been farting around - made another ...
adriamicMichelle (adriamic)chocolate chip cookies!......
sunkisd944sunkisd944 (sunkisd944) to college Three people who make me laugh: 1. caleb 2. laura 3. katherine Three things i love: 1. cheese 2.
chocolate chip cookies 3. caleb Three things i hate: 1. drama--even though i cause a lot of it 2. feeling...
rurbanekrurbanek (rurbanek)chocolate chip cookies 1 cup coffee w/half&half......
arvalin_amras: About Me!arvalin_amras (arvalin_amras) the cover of it), Ancient Relics, Rennissance and the occasional Toxic issue. FAVORITE SMELLS:
Chocolate chip cookies, the smells in a fudge shop, Feanor, when he gets in from riding...
stillsheryl: mullets and chocolate chipssheryl (stillsheryl)the party, so here is a picture. he's on the left. also, I made some
chocolate chip cookies today because one of our old roommates sent us some nestle tollhouse ...
infinitedomainMike "Fourier Transformer Extraordinaire!" (infinitedomain)I got a wild hair up my ass and decided to bake a batch of
chocolate chip cookies all by myself for the first time ever. They were the most ...
sarahless: Laguna Beaach!!Sarah (sarahless)My mom as usual cooked up Wal*Mart...she's got red velvet cupcakes with cream cheese icing,
chocolate chip cookies, a fruit tray, a vegetable tray, AND there's chip's and dip...and then ...
werewolfgroupie (in abvh100): Drabble VirginWolfie (werewolfgroupie)so be gentle! Bare feet padded across carpeted floors and a tray of freshly baked
chocolate chip cookies balanced precariously in Nathaniel's arms along with two glasses of milk. ...
citygirl_teea: Yippeecitygirl_teea (citygirl_teea)heart and I belong there. I'll give this summer a shot. I made
chocolate chip cookies last night and they were so good. I employ all of ...
red_apollo: Stolen from LaDred_apollo (red_apollo)Chocolate chip cookies [03] nachos with velveta cheese [04] reeses [05] chex mix5 bands/artists that i know the lyrics to...
___mslavigne___mslavigne (___mslavigne)yep thats right i said nappy poo! then after that i made him some
chocolate chip cookies! he liked those alot so they mustve been good. oh geeeezzz i ...
phredsackflyThe Journal of Phred (phredsackfly)on the car, our neighbor from across the street came over and handed me homemade
chocolate chip cookies. Too bad Irene started her diet. Though I did give her one. On ...
oopink_starsoo: ...so long and good night ...Sugared Dream Queen (oopink_starsoo)always giving you a hard time don't hate me even though you say you don't"
chocolate chip cookies. ahh.. i miss Decatur? but i don't want to see some people anymore. ...
pocketed_stars-devonshire- (pocketed_stars)played some cs HA! i baked all day today. 2 pumpkin pies & a batch of
chocolate chip cookies for the road. best gf ever! & i had another pie ready ...
listless_lover: So HappyApotheosis Chylde (listless_lover)made spaghetti(sp)). Then he and I made cookies. These are some of the best damn
chocolate chip cookies I've ever tasted. Mmmmmmmmmm. This entry should be so much longer, it ...
texasrain: something neat..Kelli (texasrain)went to parkdale, played with kids, and worked on hw. 5 snacks I enjoy: ice-cream, oreos,
chocolate chip cookies, popcorn, and fruit. 5 bands/artists that I know the lyrics to most of ...
felixamatrixFelix (felixamatrix)times on the way home) We fed the goldfish in the pond an entire bag of
chocolate chip cookies, had breakfast at Easy Chair, played on the GIANT playground one last ...
_lav_brownLavender Brown (_lav_brown) this was sent on his birthday, shall we? Ace, Here are the peanut butter and
chocolate chip cookies, as I promised. I hope you enjoy every bite! Oh and guess what? I was...
urhardcoreness1melissa (urhardcoreness1)foods (i like that place. it's ginormous) - bought some tomato basil bread and double
chocolate chip cookies. (delicious) - went to celebration station where i beat james at everything possible ...
inmanout9: Scrappy Dooinmanout9 (inmanout9)know. Then I made more, and it turned out delicious, and now I am making
Chocolate Chip Cookies, and they smell soo stinking good.They just finished and are in the ...
fink1390: YAY FOR COOKIESfink1390 (fink1390)chocolate chip cookies, and now i feel like an extremely fat cow. then i watched good charlotte...
crysynCrys (crysyn) though. WHAT ARE YOU LISTENING TO? Kaltes Klares Wasser - Malaria! THE LAST THING YOU ATE?
Chocolate chip cookies that my mom made earlier. IF YOU WERE A CRAYON, WHAT COLOR WOULD YOU...
ohlifenloveGaby (ohlifenlove)chocolate chip cookies (those are goooood), and oatmeal cookies (those were ok, but it was the...
cake_is_yummy21cake_is_yummy21 (cake_is_yummy21)chocolate chip cookies, and they are the best I've ever made. I like cooking, its fun!,...
uss_spudnik: COOKIESuss_spudnik (uss_spudnik)CHOCOLATE CHIP COOKIES!!! YAY!!! the first batch came out. I accidentally semi-burned them. They'll just...
not_a_girl: Monikernot_a_girl (not_a_girl) baker, baking Exalted cookies. In fact, a Sidereal Baker, making delicious, prayer-strip enhanced,
chocolate chip cookies of fate. Sidereal-tested, Pattern Spider approved. Imagine a jolly, fat lady,...
etothez: 100 factsA Swinger (etothez)can get a good grade and then go to the college I want to 6. I love
chocolate chip cookies. People call me the cookie monster 7. I watch my weight 8. I will only drink ...
britnikbritnik (britnik) Britt, Britnik, Britters Birthday: 3/17 Birthplace: the burg =Now= Current mood: bored & freaked out Current taste:
chocolate chip cookies Current hair: loose pony tail Current clothes: sprite shirt & khaki shorts Current annoyance: the m...
atheilen: ReenyAthi (atheilen) the kindest people I have ever known, and she makes amazing cheesy potatoes and
chocolate chip cookies, and being hugged by her is like being in some kind of sea...
dailyworkoutdailyworkout (dailyworkout)chocolate chip cookies.......
sunset_scorpio: 5 thingssunset_scorpio (sunset_scorpio)hours: 1. chocolate soy protein shake with nonfat milk 2. steak fries with bleu cheese dressing 3. gluten-free
chocolate chip cookies 4. spinach,......
jaystarzjaystarz (jaystarz)the Beast. we sang along and quoted almost the entire thing. Meags made us
chocolate chip cookies too. aahhh, it was a good night!......
spiledmlkfactryspiledmlkfactry (spiledmlkfactry)the universe for three hours. What we should be doing, is teaching them how to make
chocolate chip cookies. What skill is more necessary than that? Perhaps chocolate chip cookie eating ...
clavis_karenclavis_karen (clavis_karen) rice pilaf with pea salad, carmelized onions, and fresh baked honey-wheat bread. Desert was mint-
chocolate chip cookies (fresh baked). The low point of the evening however was when my back starte...
topazstar28: Jealoustopazstar28 (topazstar28) mad. Also, my brother's friend thinks I'm really weird now because I was baking
chocolate chip cookies to eat because I had a craving for them and he walked in...
anastasie: God is watchingAnastasie (anastasie)God is watching." At the other end of the table was a large pile of
chocolate chip cookies. Moving through the line a boy wrote another note to leave by ...
iamanewday: Hey to all new friendsiamanewday (iamanewday)curl up for a day with Blake and Boccelli surrounding my senses. Ok...and warm
chocolate chip cookies. But that is a temptation too hard to......
pink_nerblesKate (pink_nerbles)i need to try really hard not to have here: B&J's Cherry Garcia Pepperidge Farm Soft Baked
Chocolate Chip Cookies Mikes Hard Cranberry Lemonade Djarum Blacks ......hum.......
tragicxdevotion: mmmmMOTHERRR!!Melanie (tragicxdevotion)chocolate chip cookies.
Chocolate chip cookies are the shit. MAN, I finally started exercising again! AND AND AND I...
x_katie_jane_x: Kit list for Leeds FestivalKatie (x_katie_jane_x)if it rains Turkey sandwich 2 bars of Dairy Milk 2 lemon and lime jelly pots Bottled water Toilet roll 4
chocolate chip cookies Money Camera Kate, my gigging buddy Tickets This is what I am taking to Leeds Fest tomorrow. ...
_pinklemonade_: no subject_pinklemonade_ (_pinklemonade_)and then came back here with LJT who then proceeded to eat 10 peperidge farm
chocolate chip cookies and then a very large bowl of fruit loops {{can you say ...
zombie_mom: shameless shillingcute and cuddly, easy to feed (zombie_mom)Bought myself a pair of knee high black leather boots at Value Village. Sexy. 4. Made
chocolate chip cookies. And now I feel better. Plus, Pam has been calling me every night, ...
giveituptoyou: dergiveituptoyou (giveituptoyou)as pissed off as some things make me i just wanna hug him lol n back him
chocolate chip cookies without the chocolate chips haha so yea idk mrs nicki ( or as sr. ...
starbaby2798starbaby2798 (starbaby2798)a new job 3. my old haircut back 4. the one i love.. Name Four Scents You Love 1.
chocolate chip cookies 2. dryer sheets 3. sweet pea 4. love spell Name Four People That Know You the ...
rayne1919rayne1919 (rayne1919)and even made mashed potatoes and cooked califlower and broccoli. And I baked some
chocolate chip cookies. This was a huge day for me.......
sobersus08: about sussobersus08 (sobersus08)World season: San Diego Favorite Restaurant: Applebees! it's right down the street! Favorite late night drunken food:
chocolate chip cookies...yum! favorite song to do at karaoke: never done it favorite kind of cheap......
cheetahrobJen (cheetahrob)chocolate chip cookies with no chocolate chips. it might sound crazy but they are really...
jenner980: A little work procrastination...Spunky Bella (jenner980) music coming from Jonathan's computer 4. What was the last thing you ate? Three mini
chocolate chip cookies 5. Do you wish on stars? Indeed 6. If you were a crayon, what ...
_wicked_eyes_: I need help.Jenelle (_wicked_eyes_)take my mind off of it and make me feel better. Last night I made
chocolate chip cookies from scratch. I think......
picesofme_77picesofme_77 (picesofme_77)school which rocks! tonight while my brother was cooking dinner, I experimented. I made
chocolate chip cookies w/o the choclate chips...they are good. *tina that sweat shirt guy ...
dlamming: HomeDudley (dlamming) my parents lived, getting here about 4:45. Then I got some homemade peanut butter
chocolate chip cookies, hot out of the oven. Yum. :) On the other hand, the band ne...
feralcat21Foxy (feralcat21)whole pound of strawberries) with Fran (love him). Can't live without: Bleu cheese, Fran's mom's
chocolate chip cookies, parentheses.......
intensityoflite: movie date???skank-a-rooni-dooni (intensityoflite) i kinda want to go, but not all alone-like.... meh... oh and i heart gooey
chocolate chip cookies!......
ee_shabutieee_shabutie (ee_shabutie)day talking to so many different people i sort of just kept to myself my mom bought
chocolate chip cookies ugh fattness haha but so good i'm seeing mark rudy a lot lately its pretty sweeet since ...
kaptainkoolJack (kaptainkool)don't know why, but the word "education" always, always makes me think of Chips Ahoy
chocolate chip cookies (the blue bag kind). Likewise, the word "jury" makes me think ...
bubblegumsmilesNaomi (bubblegumsmiles)reading. I miss Hoetker's class. I miss Sean. I miss eating raspberry
chocolate chip cookies and reading Shakespeare with Jillian. I felt really stimulated then. ...
gloomydisasterSera (gloomydisaster) D: 2 tblspns spinach(35), 5 tiny homefries(50), about 3 oz pork tenderloin (171) S: 1 roll
chocolate chip cookies (980) FOOD TOTAL: 1908. EXERCISE: 15 min stationary bike (-114) 15 min elliptical (-93) ...
stillnlovewithu: Living it upstillnlovewithu (stillnlovewithu) big comfy chair watching my favorite movie Sweet Home Alabama and eating of course.
Chocolate Chip cookies and milk. Seriously I'm living up on my day off. Although This ...
miximixi: tweet tweet *nerd alert*miximixi (miximixi) the cupcakes to class tomorrow (otherwise, i'll be playing housewife yet again with the
chocolate chip cookies)! IT IS HERE! IT IS HERE! IT IS HERE! IT IS...
reyazul: Stealing from Frances.reyazul (reyazul)chocolate chip cookies 3) oven-baked brownies. 4) fresh, clean laundry. 5) vanilla 6) parlor ice cream 7) most perfumes/colognes 8) apple pie...
robbi_jo: Big gameRobbi*jo (robbi_jo)excited. I hope she has a blast here at home. =c ) Ty an I made
chocolate chip cookies tonight. They kinda sucked. The middle wouldn't flipping cook! Race @ Telstar tomorrow bright 'n' ...
rolliefraggle: stream of unconciousnessRolliefraggle (rolliefraggle)e cake. it is quite possibly the world's most perfect food, with the exception of
Chocolate Chip Cookies. when it comes to those, i am like Cookie Monster sweatin' ...
baconismynizzle: bakingAshley (baconismynizzle)decided to start baing and now I can't stop. I made cheese potatoes, mashed potatoes,
chocolate chip cookies, oatmeal cookies, blueberry muffins, baked ziti, and I'm working on a chickedn ...
callanthia: bluurbbCallanthia (callanthia)uncle on his birthday, having my little midgets help me. We made cinnamin swirl muffins,
chocolate chip cookies, and some fudgey chocolate cakes.I spent a few hours talking to the ...
royal_mommyness: sore sore soreroyal_mommyness (royal_mommyness)home with me to help out w/ Thomas while I groaned in agony and ate
chocolate chip cookies. Today he had to go back to work. bummer. But ...
veola_magicshop: How fortunate...veola_magicshop (veola_magicshop)short amount of time... Now I simply need to look up the recipes for muffins and
chocolate chip cookies, and perhaps look for one of those bread-making devices.......
alfaceAL (alface)Ten Things That Make You Happy & Tag Six Friends To Do The Same. 1. bobby 2.
chocolate chip cookies 3. girlfriends+boxed wine+sex and the city from 10am-6pm (that's right, middle of the ...
kalliegirlkallie (kalliegirl)decided he doesn't want to play there anymore. so then i pointed at the
chocolate chip cookies i made for him yesterday (homemade) and he was sooo happy. ...
ladedamanda__partyhard (ladedamanda)days. + city in 19 :) + tomorrows school days gonna be a chill day. + im eating
chocolate chip cookies/hot chocolate. + lukas + i want to kill people. + writing + good in school + my ...
cookingisfuncookingisfun (cookingisfun)Chocolate Chip Cookies 2 sticks margarine 3/4 cup white sugar 3/4 cup brown sugar 120ml applesauce 1 teaspoon vanilla 21/4 cup all purpose flour 1 teaspoon baking soda 1 teaspoon salt 2 cups chocloate chips Bake at 350......
setiqueue: Standing Still...SetiQueue (setiqueue)chocolate chip cookies, and I had 2 hamburgers for dinner last night. I weighed in this morning...
mandaj82: Mmm, Mmm Goodmandaj82 (mandaj82)chocolate), Anise cookies, Pfeffernusse, Linzer Tortes (½ recipe of apricot filling, ½ of seedless raspberry),
Chocolate Chip cookies, Spritz, Biscotti (probably chocolate-dipped), Toasted Coconut Marshmallows (completely......
sillyputty221: opening nightsillyputty221 (sillyputty221)her name is Lila and she has a cat ~2 bags of M&M's ~a bag of chewy
chocolate chip cookies (WOW FOUR C's IN A ROW!!) ~a dr. pepper ~fruit loops ~3 hot fresh tacos ...
seacret17: boredseacret17 (seacret17)since 7am and have had nothing to do. so i ate some toast and some
chocolate chip cookies and now it is 11am and i am thinking about lunch. ...
gouping_stairsgouping_stairs (gouping_stairs)So I am making chicken parmagana and pasta, with salad and galic bread along with
chocolate chip cookies and birthday cake for the dessert. I should probably try to clean the ...
zukini: Another one today? Holy SpaceCoyote.Zuki (zukini) OH I CAN'T WAIT TO SEE. LALALALA *MUSICNOTE* FUFUFUFU. I SHOULD STOP EATING ALL THOSE
CHOCOLATE CHIP COOKIES I BAKED FOR THANKSGIVING :DDD I HAVE A FEELING THERE'S GOING TO BE MO...
xgrrlseven: La la la...Derra (xgrrlseven)and I are baking tomorrow also, so that should be fun. We're making puppy chow,
chocolate chip cookies, gingerbread men, and a pumpkin pie cheesecake thing. :) Holiday food is ...
rolandkale: she was a princessrobb olson (rolandkale)actually, not so much but still. the other day Shaynee and i made Oatmeal Raisin
Chocolate Chip cookies, and Banana Nut Bread. most of those tasty treats are gone, but ...
allyaneedisluvEllen (allyaneedisluv)morning and know you don't have to get up right away 5. the smell of pumpkin
chocolate chip cookies backing in my kitchen....actually the smell of anything......
kyospantskyospants (kyospants)dinner!! OMG it was so good. i love steak... and now all i want is
chocolate chip cookies but i dont have any... and that makes me a saaaad kyo.. ...
fh_directory: Student: Skank Zero Hopeless-Savagefh_directory (fh_directory)To Be Executed For Horrible Crimes, Describe Your Last Meal: My dad's ginger chicken. And
chocolate chip cookies. Preferably with the means of escape baked into them. Describe Yourself in ...
xonexredxwallx: FuturamaRichard (xonexredxwallx)chocolate chip cookies came fresh from the oven? Petridge Farm remembers. Do you remember a time when...
alipie37: Happy Happy Dayalipie37 (alipie37) BUCK...how exciting.... i love that movie...it is soo funny... hehe and i am in the mood for
chocolate chip cookies so i went to the store and got some brake and bake ones...
mypulchritude//_My Beauty::. (mypulchritude)chocolate chip cookies......
alexandrakelleyalexandrakelley (alexandrakelley) am heating up leftover stuffed shells and have whipped up my famous nutella and
chocolate chip cookies that are to die for. Add in a bottle of red wine...
dopesiickloveCatherine (dopesiicklove)now My mom bought me 5 cases of 12 bottles of Peach Snapple, Pain killers, and
chocolate chip cookies now that i can get used to . ha <3 ......
paddington_clrepaddington_clre (paddington_clre)chocolate chip cookies! tehe.......
prakriti (in freakercise): report for this weekBette Davis Eyes (prakriti) 40 minute session. Food wise, I've been really gluttonous this week as I made homemade
chocolate chip cookies and OMG! they are yummy. On a slightly funny note, I drank a...
desaroo22: Last Couple Daysdesaroo22 (desaroo22)We Started Cooking And So Far I Have MAde Rice Crispe Squares, Puff Wheat Cake,
Chocolate Chip Cookies And So Weird Sandwich With 8 Differnet Temps. And Was Soggy It ...
ferisweeljunkie: Back From Beyondferisweeljunkie (ferisweeljunkie) reading fairy-tales and watching movies. Weekends where you make soup and salad and
chocolate chip cookies with the coolest kids in town. Weekends where you sit around on...
berchshillberchshill (berchshill) dog angel in the snow. Natooke has ruined Chips O'hoy for me with her home-made
chocolate chip cookies. Not that I should be buying cookies anyway, 10 kg and only ...
sakurasaturn: Meme: Five Guilty PleasuresKumi (sakurasaturn)names. 1) American Idol (moreover, the bad auditions or the actual top ten) 2) Famous Amos
chocolate chip cookies 3) Video games (lately, Ragnarok Online or World of Warcraft) 4) Long, ...
prettyblackhawk: Dance it through life.accidental anomaly (prettyblackhawk)asically I was nonessential the entire night: I did prep sheet, pulled stuff, baked some
chocolate chip cookies, made a shitload of frap mix, bussed tables, did dishes, etc. etc. ...
mry19355mry19355 (mry19355)chocolate chip cookies, and at present I am ingesting decorator icing (green) directly from the can...
catch22catch22 (catch22) and Penne in marscapone miso soup pepper steak and rice creamy tomato soup. Wheat bread Thinking about putting the
chocolate chip cookies to bake Yay 20 lunch/dinner meals when added to a salad and/or some bread....
writergrlsarah dessen (writergrl) FANTASTIC---wings, chips, cheese dip, pigs in a blanket, guacamole, all followed up with fresh-baked
chocolate chip cookies---but there was nary a vegetable (unless advocado counts?) to be found. Today, I...
insomniack7insomniack7 (insomniack7)a D in the class anyway. I have to see them. This weekend I made
chocolate chip cookies by popular demand. I then made some brownies that had almond extract ...
selanusZanxial (selanus)chocolate chip cookies with hazelnuts. mmmm. And on Friday I'm going to try caramel creme brulee...
mormonlover13: its been a while..Jill's page! (mormonlover13)basically i did nothing it was relaxing and sunday was ok went to church and everything and came home made
chocolate chip cookies! mmm! watched the superbowl, which was really bad... well, see..scott said he was gonna cheer ...
mixerofdrinksmixerofdrinks (mixerofdrinks)Hali gave me an awesome card with some earrings and lip gloss...Bessie made me some
chocolate chip cookies, which were very tasty. It was exciting to have so many people ...
tylorsama: Cooking adventures part 1...tylorsama (tylorsama)I've been playing with my kitchen a bit. Made some very good mocha fudge
chocolate chip cookies, though the consistency is a little iffy. And then tonight I ...
vikalicious: my dreamVikki (vikalicious)eam that involved giant sour cream and onion potatoe chips and huge soft batch homemade
chocolate chip cookies. they were literally the size of plates. i remember taking a bite ...
ahhhhhhhjessJessica (ahhhhhhhjess)chocolate chip cookies. I had to take on a crowd of drunken, angry, aggressive metalheads and T&T's...
undefinedstar (undefinedstar)chocolate chip cookies off of your lovers body Take this quiz at QuizUniverse.com......
snarkpuppie: Me want cookie.snarkpuppie (snarkpuppie)he orange syrup as we couldn't find orange blossom water in the supermarket) and mammoth
chocolate chip cookies (which ended up slightly burnt as we used the wrong oven setting). ...
grapefruit87Born to Hand Jive Jackson (grapefruit87)shut up. -i like to, as jessie puts it, "shatter everyone s little enigma" -i am never wrong -vegan
chocolate chip cookies are that of deliciousness -im tired/headachey, so......
andalokseer: Seattle TripXenia Joy (andalokseer) PROVES I DO HAVE THE SKILL. Picture by Barbara Scott 04. Ze parental units. 05. For dessert: apple thingy,
chocolate chip cookies, pineapple tart, and COCONUT COVERED FLAN. ::drool:: I am spoiled. 06. Then we went to...
nightgoblyn: It's alive! IT'S ALIVE!The Nightgoblyn (nightgoblyn) Internet Fairy and Mr. Bill for the miracle of modern computing, not to mention
chocolate chip cookies. Well, I need to go catch some sleep soon since I have to ...
interdiction642: Best Chocolate Giftsinterdiction642 (interdiction642)Candy Individually Wrapped Top searches of the day: What Is White Chocolate Made Of Online
Chocolate Chip Cookies Gourmet Chocolate Gift Basket Recipe For White Chocolate Raspberry Cheesecake Oatmeal Cranberry ...
tizzdizz: It's dark in hereTom (tizzdizz)always make music together! I'm sappy but I'm happy. Plus I still have like 3 dozen scratch-baked
chocolate chip cookies that I made that I have to......
elegantinaction: good dayelegantinaction (elegantinaction) -highfive- In 1 pkt instant oatmeal 0.75 cup Trix cereal 0.25 cup melon 1 apple 2
chocolate chip cookies 1 Laughing Cow cheese 1 mini tortilla 8 Soy Crisps 4 turkey me...
ladeedeedaladeedeeda (ladeedeeda)Chocolate Chip Cookies Fancied Up 1/4 tub Earth Balance, softened (1 stick equivalent) 1 T soy flour mixed...
nautilus_shore: PartiesSand Stroller (nautilus_shore)time to vote kiddies, which of these sounds best to you? Choose your favorites... SNACKS potato chips tortilla chips popcorn crackers
chocolate chip cookies bread sticks pretzels DRINKS rum + Shasta vodka + lemonade vodka + OJ tequila + limeade keystone other options/suggestions...? and remember ...
micha_23: just say no.micha_23 (micha_23)and waves a pipe in my face and the next thing i know we're dunking
chocolate chip cookies in......
bittencake: springbittencake (bittencake)clouds, the sweet somethings. I was dreaming about my little white tights, combing my hair, and
chocolate chip cookies. Being a child, just being. This warm sun lit up so many memories. Of tanned ...
starbuck92: bribery rulesStarbuck (starbuck92)icons. The more, the merrier. 4. New music. Good for the soul and helps me write. 5.
Chocolate chip cookies. Virtual or real, doesn't matter. I love
chocolate chip cookies!......
j9: birf-dayj9 (j9)stars all over my desk, made me a birthday tiara, and some kick ass mini
chocolate chip cookies, most of which have already been eaten, by me. Matt's taking me out ...
bahamalvr: Yawwwnnnbahamalvr (bahamalvr)YOU MISS AT TIMES? kindergarten 8. WHAT IS YOUR MOST PRIZED POSSESSION? idk 9. WHAT IS YOUR FAVORITE SMELL? Gasoline...or
chocolate chip cookies......
crochetgirl: Gakked from IlenenitaHolly (crochetgirl)to do 4. Hugs from "my" kids 3. A good book 2. Warm homemade
chocolate chip cookies with a cold glass of milk 1. Cuddling......
onetoughtator: birthday listonetoughtator (onetoughtator)all we really have out here] 4. to not be sick 5. to have baked goods [oatmeal
chocolate chip cookies are a fav. and french vanilla cupcakes] from home being accompanied by ...
mei_arizona919: Omega 3 Supplementmei_arizona919 (mei_arizona919)o prevent aging. It's ... Read moreMood foodAZCentral.com - Seeking solace in a handful of
chocolate chip cookies is a quick solution, usually regretted by the time we're swiping the ...
keitichandesu: Meghan!Kei, Nearly Graduated (keitichandesu)other news, we bought Guitar Hero. It is teh awesome. Also, we will have oatmeal raisin/
chocolate chip cookies.......
powerjazz: Ouch!powerjazz (powerjazz)I get for trying to be healthy! So in revenge I pigged out on Cheetoes,
chocolate chip cookies, and hot chocolate. Sure I'm going to regret it later but it ...
theodosiuspeacetheodosiusNpeace (theodosiuspeace)get to cook for someone now besides myself and the girl from work. i made
chocolate chip cookies after an energy burst (minus the vanilla and brown sugar). i ...
no__association: Chocolate Chip Cookies.Diane (no__association)you, better me My bitter half has bitten me Better you, better me I'm eating with my enemy Myself Myself Found pieces of
chocolate chip cookies Found pieces of
chocolate chip cookies Found pieces of chocolate chip coookies. Drink warm milk, drink ...
mousesuper314: I <3 MTCHeather (mousesuper314)DDR and SSX. that was cool. Then we got bored so we decided to make
chocolate chip cookies. They had a powder mix and all u had to do was ...
seenstercaitaseensterCAITA (seenstercaita)chocolate chip cookies. but we had no brown sugar, vanilla, or chocolate chips. that was a small problem. so,...
beccabug33becca (beccabug33)r news, I definitely found the perfect amount of time to bake my famous chocolate
chocolate chip cookies--11 minutes. That's all I can think of for my avid fans. ...
bkhill5: Good Ol' Fashion Bakingbkhill5 (bkhill5)CHOCOLATE CHIP COOKIES (yum yum yum) [IMG]http://i3.tinypic.com/waq1qf.jpg[/IMG] PUMPKIN MUFFINS (perdy good) [IMG]http://i3.tinypic.com/waq26s.jpg[/IMG] NOT exactly baking, but still yum. I made...
lateroperatorrjamie (lateroperatorr)chocolate chip cookies jme: mmm :-P vin: and chips, vin: and cake vin: and punch that no one could ever...
birdstrike42: montanaAug the Junior (birdstrike42)chocolate chip cookies with ben freeman while wearing a cow costume. don't believe me? ...
vertigo3lMatilda Wheelwright (vertigo3l) will get a surprise! I'm in the middle of baking a giant batch of
chocolate chip cookies; tomorrow is Craig's last day of school before graduation. He's been with ...
naominaomi: broooooooklyn!naomi (naominaomi) manager at angelica kitchen, who i am meeting with on monday. then i baked vegan
chocolate chip cookies. then i went to urban word and saw the new space and saw peo...
bigdamnheroinebigdamnheroine (bigdamnheroine)B.'s house and spent the night. The next day we baked a whole box of
chocolate chip cookies. Mmm. Anyway, because I had bought my banquet ticket so late, I ...
goldenpaw72: Odd Moments: Picnics and Yard Workgoldenpaw (goldenpaw72)for a picnic lunch at Whitemud Park that consided of grilled hot dogs, chips, and
chocolate chip cookies. After a peaceful relaxing lunch, the husband and I did some comparison ...
obie_in_exile: Recent PerksKTT (obie_in_exile)one is immune. you here that sanitary system? 3.I got an oven and I made real
chocolate chip cookies! 4. went to the clean beach today. small, empty and pretty. I got ...
sadiethenymph: funny little jokeSadie Franklin (sadiethenymph)the lunch line, at the other end of the table was a large pile of
chocolate chip cookies. A child had written a note, "Take all you want. God is ...
drunkatrondrunkatron (drunkatron)very successfull this year got drunk with my fam! super good times me and caro baked mint
chocolate chip cookies for everyone im talking to krista about the zine shes making and im ...
b1zfr3sh: today is mondayb1zfr3sh (b1zfr3sh)and wreckless consumption. consumption of what you ask? FOOD. i practically baked and ate three whole pillsburry
chocolate chip cookies. anyways until tomorrow or whenever i update this shit, -Aaron "b1zfr3sh" Barroso......
lablemming: Memeagelablemming (lablemming) VACATION: -Stonehenge -Manaus -The Drakensberg -The New Jersey Turnpike F) FOUR WEBSITES I VISIT DAILY: -gmail.com -sciencedirect.com -mail.yahoo.com -lablemminglounge.blogspot.com G) FOUR FAVORITE FOODS: -
chocolate chip cookies -laksa -camembert -carrots H) FOUR PLACES I'D RATHER BE: -The Wild West ('midst the sagebrush, and the...
freakaleek1: I am a pig!!!!freakaleek1 (freakaleek1)freakin pig!! I haven binged for three days, Yesterday i ate 2 eggs, and 5
chocolate chip cookies, I want to loose ten pounds by friday!! I want to loose ...
muffinmuncher (in kitcookbook)Jane (muffinmuncher)chocolate chip cookies Peppermint bark Brownie-Cookies (Brookies?) 7 Layer bars ginger cookies ghiradelli brownies blondies chocolate chip meringues M is for Mini-monsters Basic Drop Doghnuts Snickerdoodles Fudge...
the_0th3r_sldethe_0th3r_slde (the_0th3r_slde)end i just went to nicoles art class and went 'Hi!' hahah Lunch-OMGAH THEY HAD DOUBLKE
CHOCOLATE CHIP COOKIES TODAY AND IT......
specialcamperstacey (specialcamper)chocolate chip cookies this afternoon. Doctor appt. in 30 minutes, which means medicine and possible chest x-ray? Math today, wich means :(......
ironmaus: On Falling Leaves And Grass SkirtsChoo (ironmaus)a small crew to the U House and made them eat eggless peanut butter and
chocolate chip cookies that were the direct result of Miranda's skill and intuition. The ...
simpledeathwishsimpledeathwish (simpledeathwish)what to write here...all i know is that i am really happy because i made
chocolate chip cookies and they are delicious...and i love them...eat that darth vader......
glitzysara: Eeeek!GlitzySara (glitzysara)working on this dinner. We did lots of shopping, and then I baked brownies,
chocolate chip cookies, peanut butter cookies, and haystacks, and she made cupcakes. I think ...
prettydrake: story time!Rachael (prettydrake)have a secret santa + potluck at work to-morrow! I am goign to make
chocolate chip cookies. I bought Wendy an angel ornament from Jewel. tis very ...
hootiebean: -squee-Insanity (hootiebean)chocolate chip cookies. 6-7ish dozen. Lauretta is 16. my bus driver gets some, she seems as if she...